KEGG   Methanomethylovorans hollandica: Metho_0651Help
Entry
Metho_0651        CDS       T02418                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metho_0651
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metho_0651
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metho_0651
Enzymes [BR:mhz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metho_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662032..663375
Genome map
AA seq 447 aa AA seqDB search
MKLYSTNLQAAEVSFETALIEGQAPDKGLYLPRSLPLLSKEDIVSLKDKPYPEVAFRVLR
KVLEGEIDELSLKEIVYDAYNYDVPLEELNENTYIMRLDRGPTASFKDFAARLMARLMQY
YLKKDSKKITILTATSGDTGSAVAHAFYGLDNVRVIVLFPRTEVSERQRKQMTTLQKNIS
AISIDGKFDDCQAMVKSAFSDDQLRHLNLSSANSINIGRLIPQSLYYIYAYVNLCNYPEE
IIFSIPSGNFGNMMGCVLAKTMGLPVKKIVASVNENDEFPSFLSTGEYHKIVPSLNCLSN
AMNVGHPSNLARLIAVYGGQMDELGNVNKLPDMEQLRNDIYSISVTDEETKVTMRDILDS
YGILIEPHGAVGIKGLSDYRNNTADKTIAVTLETAHPAKFPEEVKSVTGIDPELPISLKD
AESKEEHMDLLTKDYEKFKEYLLSKLS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacagcactaatctccaggcagcagaagtatcttttgaaactgcccttatt
gaaggccaggccccggataaaggtctatatttacccaggtctctcccccttctgtcaaaa
gaagatattgtgtccctgaaagacaaaccatatccagaagttgcatttcgtgtactgcgc
aaggttctggaaggtgagatcgatgagctttcccttaaagagatagtttacgatgcttac
aactatgatgtgcctcttgaagaactgaacgaaaacacatatatcatgcggctggaccgt
gggcccactgcttccttcaaggatttcgcagctcgccttatggcaaggctcatgcaatat
tatctcaaaaaagatagcaagaaaataaccattcttactgctacttctggcgacacgggg
agtgcggttgctcatgctttctatggacttgataatgtcagggtcattgtacttttcccc
cgtactgaggtttccgagcgtcagcgcaagcagatgaccaccctccagaagaacataagc
gcaatatccatagatggcaagttcgatgattgtcaggctatggtcaagagtgctttctca
gatgaccagctcagacaccttaacctgtcctcagccaattctataaatattggtcgtctt
atcccgcagtctctgtactatatttatgcatatgttaatctctgtaattatcccgaagag
atcatcttttccataccttccggcaattttgggaacatgatgggttgcgtactggcaaag
acaatgggtcttccggtaaagaagatcgttgcttctgtaaacgagaacgatgagtttcct
tcattcctgagcaccggtgaatatcataagatagttccatccctcaattgtctttcaaat
gcaatgaacgtaggccatccgagcaatctggcaaggcttattgcggtgtatggtggccag
atggatgaactgggtaatgtcaacaagctgccggatatggaacaactccgcaatgatatt
tattccatttcggtgaccgatgaagaaacaaaggtcacgatgagggatattctggacagc
tatggtattcttattgagccccacggggctgtgggaataaaaggtctgtctgattacagg
aataataccgcagataaaacaatagcagtgaccctggaaacggcgcatcccgcaaagttt
ccggaagaagtgaaatcagtgacgggtattgatccggagcttcccatcagtcttaaagat
gcagaatcaaaggaagaacacatggatctccttaccaaggactatgaaaagttcaaagaa
tatctgttatcaaaacttagctaa

DBGET integrated database retrieval system