KEGG   Methanomethylovorans hollandica: Metho_1095Help
Entry
Metho_1095        CDS       T02418                                 

Definition
alpha-amylase/alpha-mannosidase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metho_1095
Enzymes [BR:mhz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Metho_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098236..1099366)
Genome map
AA seq 376 aa AA seqDB search
MESVCVCVDLHLPYHLKWYWSAEGYRRPEITTYFDQERVFTDFQRMAADIGRTNRVLERS
IDNGAAYTLNLSGTFLDQCSWDPGVLDSFRDLADTGNVAFAASTYYHSLSALYPDLTDFK
EQVWMHMEKISELFGIVPSTFVNPELLISGNIGGLLKKLGLKCMIAEGAKNLLREDVPNN
VYSDDIPTLLRHIDLSEDVSRRFSDRSWDGSPLIADKFASWVEHIEGDVVTLYLDYGTIP
WNESKAGGMFQFLTDLPLSLEEKGISMIKPEDAVKRFDKVKLNTLKTESAARYGMDGMLG
NHAQHFYLKELEIIAQELKERAKALDNAHLKHIFGYLQQSDIFLDMNTANITGYERSVNN
LSILSDFRRAVWEGSV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggtttgtgtgtgcgtggacttgcatctgccttatcatttgaaatggtactgg
tctgctgaaggttatcgtaggcctgagataactacttattttgaccaggaacgggtcttc
actgattttcagcgtatggcagccgacattggcagaactaacagggtactggaaagatct
attgacaatggagctgcctacaccctgaacctttcagggacatttttggaccagtgttcc
tgggatccgggagtactggattcgttcagagatttggccgacaccggaaatgtagcattt
gcggcatccacatattatcattcattgagtgctctttatcctgacctcacagattttaag
gagcaggtatggatgcacatggaaaagatatcggagctgtttggcatcgtgccctcaact
tttgtaaacccggagttgctgatatcaggaaacattggagggttgctcaaaaagctgggt
ttgaaatgcatgatcgcagaaggagccaaaaatctgctccgcgaagatgtgcctaataac
gtatattctgatgacattcccacgcttctgaggcatatagaccttagcgaagatgtcagc
aggcgcttctctgacaggtcatgggatggatctccactgatagccgataagttcgcttca
tgggtagagcacattgaaggtgatgttgttaccctctacctggactatggtaccattccc
tggaacgaaagcaaagcaggaggaatgttccaattcctgacagatctgccgctaagcctg
gaagaaaaaggtatcagtatgatcaaacccgaagatgccgtaaaaaggtttgacaaagta
aagctgaacacgctgaaaaccgagtctgcagctcgttacggaatggatggcatgcttggg
aatcatgcacaacatttctacctgaaggaacttgagatcatagcgcaagaactaaaagaa
cgtgccaaagctttagataatgcacatttgaaacatatttttggatatctccagcaaagt
gatatttttctggatatgaacacagccaatattaccggatatgagagatctgtgaacaat
ctatctatattatctgatttcagaagggctgtatgggagggaagtgtatga

DBGET integrated database retrieval system