KEGG   Methanomethylovorans hollandica: Metho_1154Help
Entry
Metho_1154        CDS       T02418                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mhz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1163152..1164672
Genome map
AA seq 506 aa AA seqDB search
MQLKVQPIDIKVGKFKVVLNNLDAKELGVNPGDRVRIKNHTTVTAIVDFTEDMISPGMIG
LYHEVQEQLHREWTETVEVEPAEKPKSARIIRKVMDQQKLTKEEIYELVKDITEENLTDI
EVSAFLTASYINDMTEEETEWLTRAMVDSGEKIEFDMHPIVDKHSIGGVPGNKITLLIVP
IVAANGLLIPKTSSRAITGAGGTADLMEVLAPVEFTASQIKEMTQKVGGVIVWGGATNIA
PADDKLIKVEYPLSIDPHCQLLASIMAKKSAVGADKVVIDLPMGSGTKIPDMATGRKLAR
DLMSLGERLGMEVDCALTYGSSPVGRTIGPALEVREALKVLESMEGPNSFIEKSVGLAGM
LLEMGGAAARGQGHDLALETLQNGKALAKFKEIIAIQGGDPNVTSNDIQIGEFSAEVKAP
SNGYIIEFRNKRIVQIARLAGAPNDKGAGVYIHRKLGESVKQGEPVITIYAEKEAKLQAA
LKSARQDPPLIVEGMLIERLTDIREV
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaaaagtacagcctattgatatcaaggtcggtaaattcaaggtggttttgaat
aatctggatgccaaggagcttggcgtcaatcccggggacagggtcaggataaagaatcat
acgactgttactgctattgttgatttcacggaggatatgatctctccggggatgatcgga
ctttatcatgaggtgcaggaacagctgcacagggaatggacagagaccgtggaagtggag
cctgccgagaagcccaagtctgcacgtatcatcaggaaggtcatggatcagcagaagctt
accaaggaagaaatctatgagcttgtaaaggatattacggaagagaacctcaccgatata
gaggtctcagcattccttactgcttcctatataaatgatatgacagaggaagagaccgaa
tggctgaccagggccatggtggattccggagagaagatagagtttgacatgcatcccatt
gtggacaagcactctatcggaggcgtaccaggcaacaagatcaccctgctcatagtgcct
atcgtggcagccaatggcctgctcataccaaagaccagctccagggcaataacaggggcc
ggaggcactgccgatctcatggaagtactggctcccgtggaattcactgcatcccagatc
aaggaaatgacccagaaggtcggaggtgtcatagtatggggaggagccaccaacatagcc
cctgccgatgataaactcatcaaggtggaatatccactctccatagatccccactgccag
ttgctcgcatccatcatggcaaagaagagtgcagtgggagcggacaaagtggtcatagac
ctgcccatgggttccggtaccaagataccggatatggctaccggacgcaagctcgcccgg
gacctcatgagtctgggagagcgtctgggcatggaagttgactgtgcccttacctatggt
tcatcacctgtgggaaggaccatcggtccggccctggaagttcgggaagctcttaaagtg
ctggaaagcatggaaggtcctaacagctttattgagaaaagtgttggccttgcaggtatg
cttctggagatgggcggtgcagcagcccggggacagggacacgacctggcactggagact
ctccaaaacggtaaagctctggccaagttcaaggagatcatagccatacagggtggcgat
cccaacgtaaccagcaacgatatacaaatcggtgaattcagtgcagaggtaaaagctccc
agcaatggatatatcattgagttccgcaacaagcgcatagtacagatcgcaaggctggcg
ggtgcgccaaacgacaaaggcgctggtgtgtatatccatagaaaacttggcgaatccgta
aagcagggtgaacccgttataaccatctatgcagaaaaagaggcaaaactgcaggcagct
ctcaagagtgccagacaggaccccccattgatcgtggaaggcatgcttattgaaaggctg
accgatatccgcgaggtttaa

DBGET integrated database retrieval system