KEGG   Methanomethylovorans hollandica: Metho_1430Help
Entry
Metho_1430        CDS       T02418                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mhz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mhz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425053..1426147
Genome map
AA seq 364 aa AA seqDB search
MTIRVLVVDDSALMRKIISDILNSDPDIEVIDTARNGQMAVEKVERLRPDVVTLDHEMPV
LEGLGALGYIMSECPTPVIMLTAADERGAELTLNAFEYGALDFIQKPSGTISRDIELIAE
EIRAKVKAAAKAQLKNLHFMEEHVKSSEKGKIHAENTLPISNTSKATPRRIMTKKILAIG
TSTGGPRALEKVIPKLPRDLKAAVLVVQHMPAGFTASLAQRLKVQSELEVREAKDGDLIR
EGVVLIAPGDYHMEVVQKMIDGKTVEVIALNKEPRELGVRPCVNVLFRTLAPIYGSNILS
VIMTGMGMDGAEGVERIKNAGGKAIAEDERSCVVYGMPKAIVDRGLADRVVPLEMIATAI
QQLI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagagtacttgttgttgatgattctgccctgatgcgtaagataatttcggat
atactcaacagtgatccggatatagaagttatcgataccgcacgcaatggccagatggcc
gtggaaaaggtcgaaaggctcagaccggatgtagttacactggatcacgaaatgcctgtg
ctggaaggccttggtgctctgggatatataatgagcgaatgccccacgccggtgatcatg
ctaacggctgcagacgagagaggagcagaactcacattgaatgcttttgagtatggagca
ctcgattttatccagaaaccttccggaactataagccgcgatatagaactcatcgcagag
gaaatccgggcaaaagtcaaggctgctgcaaaggcacagctcaagaacctgcatttcatg
gaagagcatgtaaaaagttccgagaaaggaaaaatacatgctgaaaataccttaccaata
tccaatacatccaaagctacccccaggcgtataatgacaaaaaagatacttgccattggt
acctccactggagggcccagagctctggagaaagtgattccaaagcttccgcgtgacctt
aaagcagcagtgctggtagtccagcatatgcctgccggatttactgcttcgctggctcag
aggctgaaagtacaatctgaactggaagtgagggaagcaaaagatggcgacctgataagg
gaaggtgttgtgctcatagcgccgggtgattatcatatggaagtagttcagaagatgata
gatggaaagacggtagaagtgatcgcgcttaacaaagaacccagggaattaggtgtcagg
ccttgcgtgaatgtgctcttcaggacattagctccaatatatggttccaacatactttcg
gtgatcatgacaggcatgggtatggatggagctgaaggtgtagagcgcataaagaatgcc
ggaggaaaggcaatagctgaagatgagagatcatgtgttgtttatgggatgccaaaagcc
atagttgatcgtggacttgcggatcgtgtggtaccccttgagatgatagccacagcaatt
cagcagctcatatga

DBGET integrated database retrieval system