KEGG   Methanomethylovorans hollandica: Metho_1430Help
Entry
Metho_1430        CDS       T02418                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Metho_1430
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Metho_1430
Enzymes [BR:mhz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Metho_1430
Two-component system [BR:mhz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Metho_1430
Bacterial motility proteins [BR:mhz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Metho_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1425053..1426147
Genome map
AA seq 364 aa AA seqDB search
MTIRVLVVDDSALMRKIISDILNSDPDIEVIDTARNGQMAVEKVERLRPDVVTLDHEMPV
LEGLGALGYIMSECPTPVIMLTAADERGAELTLNAFEYGALDFIQKPSGTISRDIELIAE
EIRAKVKAAAKAQLKNLHFMEEHVKSSEKGKIHAENTLPISNTSKATPRRIMTKKILAIG
TSTGGPRALEKVIPKLPRDLKAAVLVVQHMPAGFTASLAQRLKVQSELEVREAKDGDLIR
EGVVLIAPGDYHMEVVQKMIDGKTVEVIALNKEPRELGVRPCVNVLFRTLAPIYGSNILS
VIMTGMGMDGAEGVERIKNAGGKAIAEDERSCVVYGMPKAIVDRGLADRVVPLEMIATAI
QQLI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagagtacttgttgttgatgattctgccctgatgcgtaagataatttcggat
atactcaacagtgatccggatatagaagttatcgataccgcacgcaatggccagatggcc
gtggaaaaggtcgaaaggctcagaccggatgtagttacactggatcacgaaatgcctgtg
ctggaaggccttggtgctctgggatatataatgagcgaatgccccacgccggtgatcatg
ctaacggctgcagacgagagaggagcagaactcacattgaatgcttttgagtatggagca
ctcgattttatccagaaaccttccggaactataagccgcgatatagaactcatcgcagag
gaaatccgggcaaaagtcaaggctgctgcaaaggcacagctcaagaacctgcatttcatg
gaagagcatgtaaaaagttccgagaaaggaaaaatacatgctgaaaataccttaccaata
tccaatacatccaaagctacccccaggcgtataatgacaaaaaagatacttgccattggt
acctccactggagggcccagagctctggagaaagtgattccaaagcttccgcgtgacctt
aaagcagcagtgctggtagtccagcatatgcctgccggatttactgcttcgctggctcag
aggctgaaagtacaatctgaactggaagtgagggaagcaaaagatggcgacctgataagg
gaaggtgttgtgctcatagcgccgggtgattatcatatggaagtagttcagaagatgata
gatggaaagacggtagaagtgatcgcgcttaacaaagaacccagggaattaggtgtcagg
ccttgcgtgaatgtgctcttcaggacattagctccaatatatggttccaacatactttcg
gtgatcatgacaggcatgggtatggatggagctgaaggtgtagagcgcataaagaatgcc
ggaggaaaggcaatagctgaagatgagagatcatgtgttgtttatgggatgccaaaagcc
atagttgatcgtggacttgcggatcgtgtggtaccccttgagatgatagccacagcaatt
cagcagctcatatga

DBGET integrated database retrieval system