KEGG   Methanomethylovorans hollandica: Metho_1793Help
Entry
Metho_1793        CDS       T02418                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1781674..1782729)
Genome map
AA seq 351 aa AA seqDB search
MEKLVDSLKKLSNAHGISGHEESIRAIMEEGLKPYVDELTADKMGNLIGTKKGNGPSIMI
ATHMDEIGLMVQYIDDKGFLKFVKIGGWFDPTLHSQRVVVHTKNGPVPGVIGSKPPHVMK
EEDRKRPVKSEEMFIDVGATSRDDAEMMGIAIGTPVSMDREVVALANGKITGKAFDNRAG
CAILLEVMRQLADKDIKATVYAVGTVQEEVGLKGARTSAFSLDPDIALAVDTTISGDHPG
IDKKDAAVEQGKGGVITVADASGRGLIASPQVLKWLIETAESKHIPYQLEVGDGGTTDAT
AIHLTRAGIPCSVISVVTRYIHSPVEVVDTADVKACVDLLVSSIEAIDKYF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactggtcgattctttgaagaagttatccaatgcacatggcatctccggccat
gaggaaagtatacgtgccattatggaggaaggacttaagccctatgtggacgagctgacc
gcggataagatgggcaatctgataggcactaaaaagggaaacggcccatcaataatgatc
gcaacccatatggatgagataggtctgatggtgcagtatattgatgacaagggtttcctg
aagttcgtgaagataggtggctggttcgaccccactctgcacagccagagagttgtggtc
cataccaaaaatggtcctgttcccggagtcatcggatccaaaccacctcatgtgatgaaa
gaagaggacaggaaaagacctgtgaagtccgaggaaatgttcatcgatgtgggtgccaca
agccgcgacgatgctgaaatgatgggtattgccataggaacgcctgtttccatggacagg
gaagtagttgctcttgcaaatggtaagataacaggcaaggcttttgacaaccgtgcaggc
tgtgcaatacttctggaagttatgaggcaacttgcagataaggacatcaaagcgaccgtg
tatgccgtgggaaccgtgcaggaagaggttggtctcaaaggcgcacgtacatctgccttc
agcctggacccggatatagcccttgcagtcgacacgacaatttcaggtgatcatccgggc
attgataaaaaggatgctgcagtggaacagggtaaaggtggagttatcaccgtggcagat
gcctccggacgtggtcttattgcttcgccccaagtgcttaaatggctgattgaaaccgca
gaatcgaaacacatcccctatcagcttgaggtgggtgatggtggtactacggatgccact
gccatacaccttacaagagcgggcatcccatgcagtgtcataagcgtagttacccgttat
atacactctcccgtggaagtagtggatacagctgacgtcaaggcatgtgtagaccttctg
gtaagctcaatagaggctattgacaagtatttctga

DBGET integrated database retrieval system