KEGG   Methanomethylovorans hollandica: Metho_1793Help
Entry
Metho_1793        CDS       T02418                                 

Definition
(GenBank) peptidase family protein
Organism
mhz  Methanomethylovorans hollandica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1781674..1782729)
Genome map
AA seq 351 aa AA seqDB search
MEKLVDSLKKLSNAHGISGHEESIRAIMEEGLKPYVDELTADKMGNLIGTKKGNGPSIMI
ATHMDEIGLMVQYIDDKGFLKFVKIGGWFDPTLHSQRVVVHTKNGPVPGVIGSKPPHVMK
EEDRKRPVKSEEMFIDVGATSRDDAEMMGIAIGTPVSMDREVVALANGKITGKAFDNRAG
CAILLEVMRQLADKDIKATVYAVGTVQEEVGLKGARTSAFSLDPDIALAVDTTISGDHPG
IDKKDAAVEQGKGGVITVADASGRGLIASPQVLKWLIETAESKHIPYQLEVGDGGTTDAT
AIHLTRAGIPCSVISVVTRYIHSPVEVVDTADVKACVDLLVSSIEAIDKYF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactggtcgattctttgaagaagttatccaatgcacatggcatctccggccat
gaggaaagtatacgtgccattatggaggaaggacttaagccctatgtggacgagctgacc
gcggataagatgggcaatctgataggcactaaaaagggaaacggcccatcaataatgatc
gcaacccatatggatgagataggtctgatggtgcagtatattgatgacaagggtttcctg
aagttcgtgaagataggtggctggttcgaccccactctgcacagccagagagttgtggtc
cataccaaaaatggtcctgttcccggagtcatcggatccaaaccacctcatgtgatgaaa
gaagaggacaggaaaagacctgtgaagtccgaggaaatgttcatcgatgtgggtgccaca
agccgcgacgatgctgaaatgatgggtattgccataggaacgcctgtttccatggacagg
gaagtagttgctcttgcaaatggtaagataacaggcaaggcttttgacaaccgtgcaggc
tgtgcaatacttctggaagttatgaggcaacttgcagataaggacatcaaagcgaccgtg
tatgccgtgggaaccgtgcaggaagaggttggtctcaaaggcgcacgtacatctgccttc
agcctggacccggatatagcccttgcagtcgacacgacaatttcaggtgatcatccgggc
attgataaaaaggatgctgcagtggaacagggtaaaggtggagttatcaccgtggcagat
gcctccggacgtggtcttattgcttcgccccaagtgcttaaatggctgattgaaaccgca
gaatcgaaacacatcccctatcagcttgaggtgggtgatggtggtactacggatgccact
gccatacaccttacaagagcgggcatcccatgcagtgtcataagcgtagttacccgttat
atacactctcccgtggaagtagtggatacagctgacgtcaaggcatgtgtagaccttctg
gtaagctcaatagaggctattgacaagtatttctga

DBGET integrated database retrieval system