KEGG   Methanomethylovorans hollandica: Metho_1863Help
Entry
Metho_1863        CDS       T02418                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhz  Methanomethylovorans hollandica
Pathway
mhz00860  Porphyrin and chlorophyll metabolism
mhz01100  Metabolic pathways
mhz01110  Biosynthesis of secondary metabolites
mhz01120  Microbial metabolism in diverse environments
Module
mhz_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metho_1863
Enzymes [BR:mhz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metho_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AGB50043
UniProt: L0L0X3
Position
1856801..1857604
Genome map
AA seq 267 aa AA seqDB search
MADENKPVLAIMRPSVYKEESVKLARSMGFDVMAVPMIELTGTQDSSFKPFFEQIAKKEA
DYVIFTSANGLDYTLQKIPYVMRDMFIEALNNTNVVAIGPTTKKSLEEKGIKVMGMPGVY
SSKGLIEYLCKDVKNKNIGMARSVFGSTVLTEGLTRCGANVLETKVYSLFRPDGEEQKDL
IRTALDGKITAFAFTSSMMVHNFFEVAKELEAGDAIVQALSESIVAAIGLPTAETLRGYD
VNVSVIPDEYTFEEILKKIKDMLLACS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaaaacaaacctgttctggccattatgcggccatctgtatataaggaagaa
tcagtgaagcttgcaaggtccatgggatttgatgtaatggctgttcccatgatcgagctt
acgggaacgcaagattcttccttcaaacctttttttgagcagatagcaaaaaaagaagcc
gactacgtgatattcacaagtgccaatgggcttgattacacattgcagaaaataccatac
gttatgcgtgatatgttcatagaagctttgaataataccaatgtagtagctataggacct
actacaaagaaatctctggaagagaaaggcattaaggtcatgggcatgcccggagtgtac
agttcaaagggacttatagaatacctttgcaaggatgtaaagaataagaacataggcatg
gcacgtagtgtctttggctcaactgtgctcacagagggacttacccgctgtggcgcaaat
gtgctggaaacaaaagtttatagcctttttaggcctgatggcgaggagcaaaaagacctg
ataagaactgctctggatggcaagatcacagcttttgcctttaccagttccatgatggtg
cataatttctttgaggtggccaaagagctcgaagccggagatgcgatcgtgcaggcactc
agtgagtcaatcgtagcagctattggcttgcctacagcagaaacattgcgtggctacgat
gtgaatgtttctgttatccctgacgagtatacgttcgaagagatattaaagaagattaag
gacatgcttttggcatgttcctga

DBGET integrated database retrieval system