KEGG   Methanomethylovorans hollandica: Metho_1863Help
Entry
Metho_1863        CDS       T02418                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856801..1857604
Genome map
AA seq 267 aa AA seqDB search
MADENKPVLAIMRPSVYKEESVKLARSMGFDVMAVPMIELTGTQDSSFKPFFEQIAKKEA
DYVIFTSANGLDYTLQKIPYVMRDMFIEALNNTNVVAIGPTTKKSLEEKGIKVMGMPGVY
SSKGLIEYLCKDVKNKNIGMARSVFGSTVLTEGLTRCGANVLETKVYSLFRPDGEEQKDL
IRTALDGKITAFAFTSSMMVHNFFEVAKELEAGDAIVQALSESIVAAIGLPTAETLRGYD
VNVSVIPDEYTFEEILKKIKDMLLACS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaaaacaaacctgttctggccattatgcggccatctgtatataaggaagaa
tcagtgaagcttgcaaggtccatgggatttgatgtaatggctgttcccatgatcgagctt
acgggaacgcaagattcttccttcaaacctttttttgagcagatagcaaaaaaagaagcc
gactacgtgatattcacaagtgccaatgggcttgattacacattgcagaaaataccatac
gttatgcgtgatatgttcatagaagctttgaataataccaatgtagtagctataggacct
actacaaagaaatctctggaagagaaaggcattaaggtcatgggcatgcccggagtgtac
agttcaaagggacttatagaatacctttgcaaggatgtaaagaataagaacataggcatg
gcacgtagtgtctttggctcaactgtgctcacagagggacttacccgctgtggcgcaaat
gtgctggaaacaaaagtttatagcctttttaggcctgatggcgaggagcaaaaagacctg
ataagaactgctctggatggcaagatcacagcttttgcctttaccagttccatgatggtg
cataatttctttgaggtggccaaagagctcgaagccggagatgcgatcgtgcaggcactc
agtgagtcaatcgtagcagctattggcttgcctacagcagaaacattgcgtggctacgat
gtgaatgtttctgttatccctgacgagtatacgttcgaagagatattaaagaagattaag
gacatgcttttggcatgttcctga

DBGET integrated database retrieval system