KEGG   Methanomethylovorans hollandica: Metho_2074Help
Entry
Metho_2074        CDS       T02418                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mhz  Methanomethylovorans hollandica
Brite
Enzymes [BR:mhz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metho_2074
Transfer RNA biogenesis [BR:mhz03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metho_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2064602..2066242)
Genome map
AA seq 546 aa AA seqDB search
MDANSEFTLACRKLLEMVLNGEIRDPDQLVQAKKLVSKHHKLPSLPTNADIMISGSEEEQ
LLVRDFLRKKPVRTISGVAVIAAMTSPAPCPHGTCVPCPGGPASSFNSPQSYMGQEPSAM
RAIQYEYDPYRITAARLEQLKQIGHDIGKAELIIMGGTYSARTLDYQEWYVKRCLEAMND
FFDTQWREHVPTIGKTFPYLTLEDVQKANETAKVRNVGMTFETRPDWAKEDHVDVLLKLG
ATKVEIGVQSTYDFVLSRMNRGHTVADATEANRVLRDSALKVGFHMMPHLPGMDIEGDVR
NFKKLFIDTRFKPDYLKIYPTLVTEGTALQRMWKDGEYEALTDENAVELLAKIKSFLPKW
VRLQRIQRDIPAYQILAGTRKSNIRQLARSMLEEHGGSCQCIRCREVGHNILNGKYPHPD
NIKLVVEKYDCCGGVEHFISFEDIQSDILIGFLRLRFPHDPYRPELQNSALVRELHVYGS
MVPVGEHAKEYAWQHRGYGAELLAHAEEVAKGAGFKKISVISGIGVREYYRKQGYILDGV
YMSKWF
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaaatagtgaattcacactggcttgccgcaagcttctggaaatggtgcttaat
ggcgagatacgggatccggatcaattggttcaggcaaagaaacttgtaagtaaacatcac
aaacttccttcactgcctacaaatgcggacattatgatttccggtagcgaagaagagcaa
ctattggtaagggatttccttcggaaaaaaccggttcgtactatctcaggtgtagctgtg
atcgcagctatgacatcgcctgccccctgcccccatggcacatgtgttccctgcccagga
ggcccagcttcttcttttaactcgccgcaaagctatatggggcaggaaccctctgcaatg
cgcgcgatccaatatgagtatgatccatacaggataaccgctgcccgtcttgagcaatta
aaacagatagggcatgatatagggaaagccgaattgatcataatggggggaacatattca
gcccgcactttagactatcaggaatggtatgtaaaacgatgtcttgaagcaatgaacgat
ttttttgatacccaatggcgtgaacatgtccctactattggtaagaccttcccctacctc
actcttgaggacgtgcagaaggccaatgagacagcaaaggtccgcaatgtaggtatgaca
tttgagaccaggccagactgggctaaagaagatcatgtagatgtactgttaaaattaggt
gccaccaaagttgagatcggagtgcagagcacctatgattttgtcctttccaggatgaac
cgtgggcatactgttgcagatgccacagaggctaatagggttctaagggacagcgctctg
aaagtaggttttcacatgatgcctcatcttccgggaatggatattgaaggggatgtgcgc
aatttcaaaaaactttttatagataccagattcaagccggattatctgaaaatatatcct
acactggtcacagaggggacagcacttcagagaatgtggaaggacggggaatatgaagcc
cttacagatgaaaatgctgtggaactgcttgctaagatcaaatccttcctgcctaaatgg
gtaagattacaacggatacagcgggatattcctgcttatcagatacttgcaggtactcgt
aaaagcaatatcagacaacttgctagaagtatgctggaagaacatggtggttcctgtcag
tgcatccgctgccgcgaggtaggtcataatattcttaatggaaagtatcctcatcctgac
aacattaagctggttgttgaaaaatatgattgttgtggtggtgtggaacatttcatatct
tttgaagatatacaatcggatattttgataggttttttgagattgaggttccctcatgat
ccttaccgacccgagcttcagaattcagctctggtcagggagttgcatgtatacggatct
atggttcctgtaggtgaacatgcaaaagaatatgcctggcagcacagaggctatggagca
gaattgcttgcacatgcggaagaagtggcaaagggtgcaggctttaaaaagatctctgtt
ataagtggtattggagtaagggaatattatcgtaagcagggttatattttggatggggtc
tacatgtctaagtggttttag

DBGET integrated database retrieval system