KEGG   Methanomethylovorans hollandica: Metho_2438Help
Entry
Metho_2438        CDS       T02418                                 

Definition
2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metho_2438
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metho_2438
   00020 Citrate cycle (TCA cycle)
    Metho_2438
   00620 Pyruvate metabolism
    Metho_2438
   00640 Propanoate metabolism
    Metho_2438
   00650 Butanoate metabolism
    Metho_2438
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metho_2438
   00680 Methane metabolism
    Metho_2438
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metho_2438
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metho_2438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2402574..2403122
Genome map
AA seq 182 aa AA seqDB search
MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRL
RSQVYEPDYVIVQDPTLIEVVDVASGLKEDGIIIINSEFDPSTFKLNTKAKVVTVNATKI
ALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGKVGERNAEAIQQAYDMMKEA
NV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatacgaatacacggccggggaggccagggttcggtcactgctgccgagctt
ttagccgttgcagcttttgctgatgggaaattcagccaggcgttcccagcttttggagtg
gaaagaagaggagcacctgtacaggcgttcacaagaatggatgacacgcctataagactc
agaagccaggtatacgaacctgactacgtcatcgtgcaggaccctacccttatagaggta
gtagatgttgcaagtggcctgaaggaagatggaataattatcataaacagtgaatttgac
ccctcgactttcaaactcaacactaaggccaaagttgtaaccgttaatgccacaaagatc
gcacttgagatcattggcagaccaatagtcaatacagtgctactcggagcctttgcgggg
gctaccggtaatataaggcctgagtctatcaaggaagcggttaaagagagattcccgggc
aaagtaggagagagaaatgctgaagccatccaacaggcatacgacatgatgaaggaggcc
aatgtatga

DBGET integrated database retrieval system