KEGG   Methanomethylovorans hollandica: Metho_2439Help
Entry
Metho_2439        CDS       T02418                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mhz  Methanomethylovorans hollandica
Pathway
mhz00010  Glycolysis / Gluconeogenesis
mhz00020  Citrate cycle (TCA cycle)
mhz00620  Pyruvate metabolism
mhz00633  Nitrotoluene degradation
mhz00640  Propanoate metabolism
mhz00650  Butanoate metabolism
mhz00680  Methane metabolism
mhz00720  Carbon fixation pathways in prokaryotes
mhz01100  Metabolic pathways
mhz01120  Microbial metabolism in diverse environments
mhz01130  Biosynthesis of antibiotics
mhz01200  Carbon metabolism
Module
mhz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metho_2439
   00020 Citrate cycle (TCA cycle)
    Metho_2439
   00620 Pyruvate metabolism
    Metho_2439
   00640 Propanoate metabolism
    Metho_2439
   00650 Butanoate metabolism
    Metho_2439
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metho_2439
   00680 Methane metabolism
    Metho_2439
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metho_2439
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metho_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_10 Fer4_4 Fer4_15 Fer4_17 Fer4_13 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AGB50581
UniProt: L0KZP3
Position
2403119..2403379
Genome map
AA seq 86 aa AA seqDB search
MKITIGGVCEPATTLANKTGGWRTFKPVYDYDKCIKCKLCELLCPDMAVLPREDGYFQFD
YDYCKGCGVCANECPKTAITMVLEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaagataactatcggaggagtctgtgaacccgccaccacattggccaacaagactggt
ggctggagaactttcaagcctgtgtacgactatgacaaatgtatcaaatgcaagctgtgc
gagctgttgtgcccggacatggccgtgttgccccgagaggacggatatttccagttcgac
tatgattattgcaaaggatgcggtgtatgcgccaacgaatgtcctaagacggctataacc
atggtactggaggagaagtaa

DBGET integrated database retrieval system