KEGG   Methanomethylovorans hollandica: Metho_2439Help
Entry
Metho_2439        CDS       T02418                                 

Definition
2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mhz  Methanomethylovorans hollandica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metho_2439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metho_2439
   00020 Citrate cycle (TCA cycle)
    Metho_2439
   00620 Pyruvate metabolism
    Metho_2439
   00640 Propanoate metabolism
    Metho_2439
   00650 Butanoate metabolism
    Metho_2439
  Energy metabolism
   00680 Methane metabolism
    Metho_2439
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metho_2439
Enzymes [BR:mhz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metho_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2403119..2403379
Genome map
AA seq 86 aa AA seqDB search
MKITIGGVCEPATTLANKTGGWRTFKPVYDYDKCIKCKLCELLCPDMAVLPREDGYFQFD
YDYCKGCGVCANECPKTAITMVLEEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaagataactatcggaggagtctgtgaacccgccaccacattggccaacaagactggt
ggctggagaactttcaagcctgtgtacgactatgacaaatgtatcaaatgcaagctgtgc
gagctgttgtgcccggacatggccgtgttgccccgagaggacggatatttccagttcgac
tatgattattgcaaaggatgcggtgtatgcgccaacgaatgtcctaagacggctataacc
atggtactggaggagaagtaa

DBGET integrated database retrieval system