KEGG   Mycobacterium intracellulare ATCC 13950: OCU_02890Help
Entry
OCU_02890         CDS       T02158                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCU_02890
Enzymes [BR:mia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     OCU_02890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292608..293612
Genome map
AA seq 334 aa AA seqDB search
MTFSAARAVARWITPFLTITAVAGIGLVCDPVPVRPAPTVRLASDGNPLDGAPFYVNPTS
AAMRAAQSADPPSAELTAIANTPQAYWIVPGGSAATVGKYVGDAAAAGAIPVLAIYGIPH
RDCGSFAAGGMGSGADYRSWIDGIAGGVGTSRVAIIVEPDALAMADCLSGDQRQERFDLV
HYAVDTLTKDPNAAVYIDAGHLRWHSAEDMAARLNQAGVGHARGFSVNTANFFTTEDEIG
YGEAISGLTNGSHYVIDTSRNGAGPAPDSELNWCNPSGRALGTPPTASTAGAHADAYLWI
KRPGESDGTCGKGDPPAGHFVNQYAIDLAHNTGH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttctcagctgctcgtgcagtcgcacgatggatcaccccgttcctgacgatcacc
gccgtcgccggcatcggccttgtctgcgacccggtgccggtccgtcccgccccgacggtg
cgtttggcctccgatggcaacccactggacggggcgccgttctacgtcaaccccacgtcg
gcggccatgcgcgccgcccagagcgccgatccgccgagtgccgagttgaccgcgatcgcc
aatacgccgcaggcgtactggatcgtcccgggcggttccgcagcaacggtcgggaagtac
gtcggcgacgcggccgccgccggcgccatcccggtgctggcgatctacggaatcccccat
cgcgactgcggcagcttcgccgcgggcggcatggggtcgggcgccgactaccggagctgg
atcgatgggatcgccggcggcgtgggcacctcgcgggtggcgatcatcgtcgagcccgat
gcgctcgccatggccgactgcctctcgggtgatcagcgccaagaacggttcgatctggtt
cattacgccgtcgacacgctgacgaaggatccgaacgcggccgtgtacatcgatgcgggt
cacctgcgttggcacagtgccgaggacatggccgccaggctgaatcaggccggcgtcggt
cacgcgcggggcttcagcgtcaacaccgcgaacttcttcaccaccgaggacgaaatcggt
tacggcgaagcgatttcgggactcaccaacggttcgcactacgtgatcgacacgtcgcgc
aacggtgccggaccggcgcctgattccgagctcaactggtgcaatcccagcggccgagcg
ttgggcaccccgcccaccgcctcgaccgcgggtgcgcacgccgacgcctacctgtggatc
aaacgtcccggcgaatccgacgggacgtgcggcaagggtgatccgccggcgggccacttc
gtgaatcagtacgccatcgatctggcccacaacaccggccactag

DBGET integrated database retrieval system