KEGG   Mycobacterium intracellulare ATCC 13950: OCU_03470Help
Entry
OCU_03470         CDS       T02158                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mia03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351813..352424
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLAKVRDGVRFCAVCG
NVSDNERCRICADPRRDGSQVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLSRIGERVDDVDITEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaggacccgtccaggatttgatcgacgagctgggcaagctgcccggcatcggg
cccaagagcgcccagcgcatcgccttccacctgctgtcggttgagccgccggacatcgac
cggctgaccgcggtgctggccaaggtgcgcgacggcgtgcggttctgtgcggtgtgcggc
aacgtctccgacaacgaacggtgccggatctgcgccgatccgcggcgggacgggtcgcag
gtttgcgtcgtcgaggaaccgaaggacgtgcaggccgtcgagcgcacccgcgaattccgc
ggccgctatcacgtgctgggcggggcgctcgatccgctgtccggggtggggcccgaccag
ctgcggatccgcgagctgctgagccggatcggggagcgggtcgacgacgtcgacatcacc
gaggtgatcatcgccaccgacccgaacaccgagggcgaggcgacggccacctacctggtg
cggatgctgcgtgacatccccggcctgaccgtgacgcggatcgcctccgggctgccgatg
ggcggtgacctggagttcgccgacgagctgacgctcggccgcgcgctggccggccgccgg
gccatggtctga

DBGET integrated database retrieval system