KEGG   Mycobacterium intracellulare ATCC 13950: OCU_03470Help
Entry
OCU_03470         CDS       T02158                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCU_03470
DNA repair and recombination proteins [BR:mia03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      OCU_03470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
351813..352424
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLAKVRDGVRFCAVCG
NVSDNERCRICADPRRDGSQVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLSRIGERVDDVDITEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaaggacccgtccaggatttgatcgacgagctgggcaagctgcccggcatcggg
cccaagagcgcccagcgcatcgccttccacctgctgtcggttgagccgccggacatcgac
cggctgaccgcggtgctggccaaggtgcgcgacggcgtgcggttctgtgcggtgtgcggc
aacgtctccgacaacgaacggtgccggatctgcgccgatccgcggcgggacgggtcgcag
gtttgcgtcgtcgaggaaccgaaggacgtgcaggccgtcgagcgcacccgcgaattccgc
ggccgctatcacgtgctgggcggggcgctcgatccgctgtccggggtggggcccgaccag
ctgcggatccgcgagctgctgagccggatcggggagcgggtcgacgacgtcgacatcacc
gaggtgatcatcgccaccgacccgaacaccgagggcgaggcgacggccacctacctggtg
cggatgctgcgtgacatccccggcctgaccgtgacgcggatcgcctccgggctgccgatg
ggcggtgacctggagttcgccgacgagctgacgctcggccgcgcgctggccggccgccgg
gccatggtctga

DBGET integrated database retrieval system