KEGG   Mycobacterium intracellulare ATCC 13950: OCU_03660Help
Entry
OCU_03660         CDS       T02158                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OCU_03660
Enzymes [BR:mia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OCU_03660
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCU_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371512..373038
Genome map
AA seq 508 aa AA seqDB search
MAEFAEFVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSS
VLTSVLNRANLAPKNIAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALGAD
GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFAIPRAMLPRIGPSSSPQPYGVTAETGPA
GGEIAITGVLGDQHAAMVGQVCLAEGEAKNTYGTGNFLLLNTGETIVRSDNGLLTTVCYQ
FGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSEALARQVDDNGGVYFVPAFSGLF
APYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMAADSGVRLEVLKVDGGI
TGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPADLRANWQEGRRWSP
TWNDEQRAEGYAGWRKAVQRTLDWVSIT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagttcgccgaattcgtggccgctatcgaccaggggacgaccagcacgcgctgc
atgatcttcgatcacgagggtgccgaggtggcccgccaccagctcgagcacgaacagatc
ctgccccaggcgggctgggtcgagcacgacccggtggagatctgggaacgtacctcctcg
gtgctgacctccgtgctcaaccgtgccaacctggcgccgaaaaacattgccgcgctgggt
atcacgaaccagcgcgagacgacgctggtctggaaccgcaagaccggacggccctattac
aacgcgatcgtctggcaggacacccgcaccgaccggatcgcgtcggcgctgggagccgac
ggccggggcgaggtgatccgccgcaaggcgggacttcccccggcgacgtacttctccggc
gcaaagctgcgatggatcttggagaatgtcgacggggtgcgcgacgccgccgagcgtggc
gacgcgttgttcggcaccccggacacctgggtgttgtggaacctgaccgggggtccgcgg
ggcggcgtgcacgtcaccgacgtgaccaacgccagccggaccatgctgatgaacctcgag
accctggactgggacgacgagttgctgtcattctttgcgatcccgcgcgcgatgctgccg
cggatcgggccgtcgtcgtcgccgcagccctacggggtgacggccgagaccggcccggcg
ggcggagagattgcgatcacgggcgtgctgggtgaccagcacgcggcgatggtggggcag
gtgtgtctggccgagggggaggcgaaaaacacctatggcaccggcaatttcctgctactg
aacaccggcgagacgatcgtgcggtccgacaacgggctgctgaccaccgtctgctaccag
ttcggggacgccaaacccgtttacgcacttgagggttcgatcgcggtgacgggcgcggcc
gtgcaatggctgcgcgatcagctgggcatcataagcggggccgcgcaaagcgaggcgctg
gcccgccaggtcgacgacaacggcggcgtctatttcgtcccggcgttttccgggttgttc
gccccctactggcgatccgatgcccggggcgcgatcgtggggctgtcccgattcaacacc
aacgcgcatctggcccgggccaccctggaggcgatctgctaccagagccgcgacgtggta
gacgcgatggccgcggattccggtgtgcgccttgaggttttgaaggtcgacggtggtatc
accggcaatgacctgtgcatgcagatccaggccgacgtgctgggcgtggacgtggtgcgt
ccggtggtcgccgagacgacggcgctgggcgccgcgtacgcggccggcctggccgtgggg
ttctgggccgacccggcggacctgcgcgccaactggcaggagggccggcgttggtcgccg
acctggaacgacgagcagcgcgccgaggggtacgcgggctggcgcaaggccgtgcagcgg
accctggattgggtctccatcacctga

DBGET integrated database retrieval system