KEGG   Mycobacterium intracellulare ATCC 13950: OCU_03660Help
Entry
OCU_03660         CDS       T02158                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mia00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
371512..373038
Genome map
AA seq 508 aa AA seqDB search
MAEFAEFVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSS
VLTSVLNRANLAPKNIAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALGAD
GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFAIPRAMLPRIGPSSSPQPYGVTAETGPA
GGEIAITGVLGDQHAAMVGQVCLAEGEAKNTYGTGNFLLLNTGETIVRSDNGLLTTVCYQ
FGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSEALARQVDDNGGVYFVPAFSGLF
APYWRSDARGAIVGLSRFNTNAHLARATLEAICYQSRDVVDAMAADSGVRLEVLKVDGGI
TGNDLCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWADPADLRANWQEGRRWSP
TWNDEQRAEGYAGWRKAVQRTLDWVSIT
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagttcgccgaattcgtggccgctatcgaccaggggacgaccagcacgcgctgc
atgatcttcgatcacgagggtgccgaggtggcccgccaccagctcgagcacgaacagatc
ctgccccaggcgggctgggtcgagcacgacccggtggagatctgggaacgtacctcctcg
gtgctgacctccgtgctcaaccgtgccaacctggcgccgaaaaacattgccgcgctgggt
atcacgaaccagcgcgagacgacgctggtctggaaccgcaagaccggacggccctattac
aacgcgatcgtctggcaggacacccgcaccgaccggatcgcgtcggcgctgggagccgac
ggccggggcgaggtgatccgccgcaaggcgggacttcccccggcgacgtacttctccggc
gcaaagctgcgatggatcttggagaatgtcgacggggtgcgcgacgccgccgagcgtggc
gacgcgttgttcggcaccccggacacctgggtgttgtggaacctgaccgggggtccgcgg
ggcggcgtgcacgtcaccgacgtgaccaacgccagccggaccatgctgatgaacctcgag
accctggactgggacgacgagttgctgtcattctttgcgatcccgcgcgcgatgctgccg
cggatcgggccgtcgtcgtcgccgcagccctacggggtgacggccgagaccggcccggcg
ggcggagagattgcgatcacgggcgtgctgggtgaccagcacgcggcgatggtggggcag
gtgtgtctggccgagggggaggcgaaaaacacctatggcaccggcaatttcctgctactg
aacaccggcgagacgatcgtgcggtccgacaacgggctgctgaccaccgtctgctaccag
ttcggggacgccaaacccgtttacgcacttgagggttcgatcgcggtgacgggcgcggcc
gtgcaatggctgcgcgatcagctgggcatcataagcggggccgcgcaaagcgaggcgctg
gcccgccaggtcgacgacaacggcggcgtctatttcgtcccggcgttttccgggttgttc
gccccctactggcgatccgatgcccggggcgcgatcgtggggctgtcccgattcaacacc
aacgcgcatctggcccgggccaccctggaggcgatctgctaccagagccgcgacgtggta
gacgcgatggccgcggattccggtgtgcgccttgaggttttgaaggtcgacggtggtatc
accggcaatgacctgtgcatgcagatccaggccgacgtgctgggcgtggacgtggtgcgt
ccggtggtcgccgagacgacggcgctgggcgccgcgtacgcggccggcctggccgtgggg
ttctgggccgacccggcggacctgcgcgccaactggcaggagggccggcgttggtcgccg
acctggaacgacgagcagcgcgccgaggggtacgcgggctggcgcaaggccgtgcagcgg
accctggattgggtctccatcacctga

DBGET integrated database retrieval system