KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04130Help
Entry
OCU_04130         CDS       T02158                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00010  Glycolysis / Gluconeogenesis
mia00620  Pyruvate metabolism
mia00640  Propanoate metabolism
mia00680  Methane metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_04130
   00620 Pyruvate metabolism
    OCU_04130
   00640 Propanoate metabolism
    OCU_04130
  Energy metabolism
   00680 Methane metabolism
    OCU_04130
Enzymes [BR:mia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     OCU_04130
Lipid biosynthesis proteins [BR:mia01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   OCU_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFC41633
UniProt: H8IMH2
Position
complement(411418..413373)
Genome map
AA seq 651 aa AA seqDB search
MTATNSAGPSSYPPSARFAEQANAGEELYRDAERDRLAFWAEQANRLSWATPFTEVLDWS
DAPFAKWFGDGKLNVAYNCVDRHVEAGHGDRVAIHWEGEPVGDHRSLTYSQLQTEVCKAA
NALTDLGLVAGDRVAIYLPLIPEAVIAMLACARLGIMHSVVFAGFTAKALQARIADADAK
LLITSDGQFRRGKPAPLKDAADEAVSDPDSPIEHVVVVRRTGIDVSWNDDRDLWWHDVVD
AASPEHTPQPFDAEQPLFLLYTSGTTGKPKGIVHTSGGYLTHAAYTHYYVFDIKADSDVF
WCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDSPSQHRHFEIIEKYGVTIYYTAPTLI
RTFMKWGREVPDAHDLTSLRLLGSVGEPINPEAWRWYRKVIGADSLPIVDTWWQTETGAT
MISPLPGIAAAKPGSAMRPLPGVSAKIVDDHGEELPPPSEDKGEHVTGYLVLDQPWPSML
RGIWGDPQRYVETYWSRFAEQGWYFAGDSAYYDTDGDIWVVGRIDDVMNVSGHRLSAAEV
ESALVGHAAVAEAAVVGATDETTGQAICAFVVLCADFEVHDGIVDDLRVEVAREISPIAR
PREVHVVPELPKTRSGKIMRRLLRDIAENRELGDTSTLLDPGVFDAIRAAK
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaccaactctgcgggcccctcgtcgtatcccccgtcggcgcgattcgccgaa
caagccaatgcgggcgaggagctgtaccgcgacgccgagcgggaccggctggccttttgg
gccgagcaggccaaccggttgtcctgggcgacgccgttcaccgaagtgctggactggtcc
gacgcgccgttcgccaaatggttcggcgacggcaagctcaacgtcgcatacaactgcgtg
gaccgccacgtggaggccggccacggggatcgggtcgcaatccattgggagggcgagccc
gtcggtgaccaccgcagcctgacctactcgcagctgcaaaccgaggtctgcaaggccgcc
aacgcgctgaccgatctcggcctggtggccggtgaccgcgtcgccatctacctgccgctg
atcccggaggccgtgatcgcgatgctggcctgcgcgcgcctcggcatcatgcacagcgtc
gtgttcgccggcttcaccgccaaagcgctgcaggcccgcatcgccgacgccgacgccaag
ctgctgatcaccagcgacgggcagttccgccgcggcaagcccgcgcccctcaaggacgcc
gccgacgaggcggtctcggacccggacagccccatcgagcacgttgttgtggtgcggcgc
accggaattgacgtgtcctggaacgacgaccgcgatctgtggtggcacgacgtcgtcgac
gcagcctcccccgaacacaccccgcagccgttcgacgccgaacaaccgttgttcctgctg
tacacctcgggaaccaccggcaagcccaagggcatcgtgcacaccagcggcggctacctg
acccatgccgcctacacgcactactacgtcttcgacatcaaggccgacagcgacgtgttc
tggtgcaccgccgacatcggctgggtcaccggacacacctacggtgtctacggcccgctg
gccaacggcgtcaccgaggttctctacgaaggcacacccgacagcccgtcgcagcaccgg
catttcgagatcatcgaaaagtacggcgtgacaatctattacaccgcgcccacgctgatc
cgcacgttcatgaagtggggccgtgaggttcccgacgcgcacgacctgaccagcttgcgg
ctgctggggtcggtcggcgagccgatcaaccccgaagcatggcgctggtaccgcaaggtg
atcggcgccgacagccttccgatcgtcgacacctggtggcagaccgagaccggcgccacg
atgatctccccgttgcccggaatcgctgcggccaaaccgggttcggcgatgcggccgctg
ccgggtgtctcggcgaagatcgtcgacgaccacggcgaggagctgcccccaccgagcgag
gacaagggcgagcacgtcaccggctacctggtgctggaccagccgtggccgtcgatgctg
cgcggcatttggggagatccgcaacgttatgtcgagacctactggtcccgattcgccgag
caaggctggtatttcgccggtgacagcgcctattacgacaccgacggcgacatctgggtg
gtcggccgcatcgacgacgtgatgaacgtgtcggggcatcggctctccgcggccgaggtg
gagtcggcgctggtcggccacgccgcggtggccgaggcggcggtggtcggcgcgaccgac
gagacgaccggccaggccatctgcgcgttcgtcgtcttgtgcgcggatttcgaagtgcat
gacgggatcgtcgacgacctgcgcgtcgaggtggcccgggagatctcccccatcgcacgc
ccgcgcgaggtgcacgtggtgcccgagctacccaagacccgcagcggcaagatcatgcgc
aggctgttgcgggacatcgccgaaaaccgcgaattgggcgacacgtcaacgctgctcgat
cccggcgtgttcgacgcgatcagggcggcgaaatag

DBGET integrated database retrieval system