KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04610Help
Entry
OCU_04610         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00790  Folate biosynthesis
mia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCU_04610
Enzymes [BR:mia01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     OCU_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF5132
Motif
Other DBs
NCBI-ProteinID: AFC41681
UniProt: H8IN94
Position
461605..462432
Genome map
AA seq 275 aa AA seqDB search
MGVLNVTDDSFSDGGRYLDPDKAVAHGLALAADGADIVDVGGESTRPGATRVDARVEASR
VVPVVKELSSQGITVSIDTMHADVARAALCSGARIVNDVSGGRADPAMAPLLAEAKVPWV
LMHWRSVSAQRPHAAPDYRDVVAEVRAELLASVDAAVSAGVDPAQLMIDPGLGFAKTGQH
NWALLHALPRLVATGIPVLLGASRKRFLGTLLAGPDGSPRPPDGRETATAVISALAALHG
AWGVRVHDVRATVDALKVVAAWNDETHTGLAEHDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggagttctgaacgtcactgacgattcgttctccgacggcggccgctatctcgacccc
gacaaagccgtggcacacggattggcgcttgccgccgacggcgccgacatcgtcgacgtc
gggggagaatccacccgtcccggtgccacgcgcgtcgacgcccgtgtcgaggcctcccgg
gtcgtccccgtggtcaaagagctttcctcgcaaggcattacggtgagcatcgataccatg
cacgccgacgtcgcgcgggcggcgctgtgcagcggtgcgcggatcgtcaacgacgtgtcc
ggcggccgggccgatcccgcgatggcgccgctgctggccgaggcgaaagtgccttgggtg
ctgatgcattggcgctccgtgtcggcgcagcgtccgcacgcggccccggactatcgtgac
gtggtcgccgaggtgcgcgccgaattgcttgccagtgtcgacgccgcggtgtccgccggt
gtcgatcccgctcagctgatgatcgatccggggctgggattcgccaagacgggacaacac
aattgggcgctgctgcatgcgctgccgcgattggtcgccaccgggatcccggtgctgctg
ggcgcgtcgcgcaaacggttcctcggtacgttgctggccgggcccgacggttcgccgcgg
ccccccgacgggcgtgagacggcgaccgcggtgatttccgcgctcgccgcgctgcacggg
gcctggggggtacgggtgcacgatgtgcgcgccacggtcgatgcgctcaaggtcgtggcg
gcgtggaacgacgagacgcacactgggctggctgaacacgatggctga

DBGET integrated database retrieval system