KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04610Help
Entry
OCU_04610         CDS       T02158                                 

Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mia00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461605..462432
Genome map
AA seq 275 aa AA seqDB search
MGVLNVTDDSFSDGGRYLDPDKAVAHGLALAADGADIVDVGGESTRPGATRVDARVEASR
VVPVVKELSSQGITVSIDTMHADVARAALCSGARIVNDVSGGRADPAMAPLLAEAKVPWV
LMHWRSVSAQRPHAAPDYRDVVAEVRAELLASVDAAVSAGVDPAQLMIDPGLGFAKTGQH
NWALLHALPRLVATGIPVLLGASRKRFLGTLLAGPDGSPRPPDGRETATAVISALAALHG
AWGVRVHDVRATVDALKVVAAWNDETHTGLAEHDG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggagttctgaacgtcactgacgattcgttctccgacggcggccgctatctcgacccc
gacaaagccgtggcacacggattggcgcttgccgccgacggcgccgacatcgtcgacgtc
gggggagaatccacccgtcccggtgccacgcgcgtcgacgcccgtgtcgaggcctcccgg
gtcgtccccgtggtcaaagagctttcctcgcaaggcattacggtgagcatcgataccatg
cacgccgacgtcgcgcgggcggcgctgtgcagcggtgcgcggatcgtcaacgacgtgtcc
ggcggccgggccgatcccgcgatggcgccgctgctggccgaggcgaaagtgccttgggtg
ctgatgcattggcgctccgtgtcggcgcagcgtccgcacgcggccccggactatcgtgac
gtggtcgccgaggtgcgcgccgaattgcttgccagtgtcgacgccgcggtgtccgccggt
gtcgatcccgctcagctgatgatcgatccggggctgggattcgccaagacgggacaacac
aattgggcgctgctgcatgcgctgccgcgattggtcgccaccgggatcccggtgctgctg
ggcgcgtcgcgcaaacggttcctcggtacgttgctggccgggcccgacggttcgccgcgg
ccccccgacgggcgtgagacggcgaccgcggtgatttccgcgctcgccgcgctgcacggg
gcctggggggtacgggtgcacgatgtgcgcgccacggtcgatgcgctcaaggtcgtggcg
gcgtggaacgacgagacgcacactgggctggctgaacacgatggctga

DBGET integrated database retrieval system