KEGG   Mycobacterium intracellulare ATCC 13950: OCU_04630Help
Entry
OCU_04630         CDS       T02158                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mia00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462888..463397
Genome map
AA seq 169 aa AA seqDB search
MVLSIGSNLGDRLARLQSVVDGLGDTVLAVSPVYETDPWGRVDQAPFLNAVLIADDPACD
GQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQTEVTSRENNLTLPHPLAHLRAF
VLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLTLELTT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttgtccatcgggtccaacctgggggaccggctggcgcggttgcagtcggtcgtc
gacgggctgggggacacggtgctcgccgtgtcaccggtgtacgagaccgacccttggggc
cgggtcgatcaggcgccgttcctcaacgcggtgctgatcgccgacgacccggcctgcgac
gggcagggctggctggcccgggcgcaggagttcgagcgcgcggcgggcagggtccgcggc
gagcgctgggggccgcgcaccctcgacgtcgacctgatcgcctgttacgggcaaaccgag
gtgacctcgcgggagaacaacctgacgctgccgcatccgctggcccatttgcgggccttc
gtgctgatcccctggctggccgtcgacccggacgctcggctgacggtcgccgaagggccg
cgtcccgtcgcgcagttgctggccgaactggagcccgccgaccgtgccgccgtacggcgc
tccgacctgacgctcgagctcacaacctga

DBGET integrated database retrieval system