KEGG   Mycobacterium intracellulare ATCC 13950: OCU_09450Help
Entry
OCU_09450         CDS       T02158                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00020  Citrate cycle (TCA cycle)
mia00640  Propanoate metabolism
mia00660  C5-Branched dibasic acid metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
Module
mia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCU_09450
   00640 Propanoate metabolism
    OCU_09450
   00660 C5-Branched dibasic acid metabolism
    OCU_09450
Enzymes [BR:mia01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCU_09450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFC42165
UniProt: H8ITL0
Position
931876..933039
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPDDAYEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLATARSIAEQGHLPAEVLDAAAVTINKLWEVF
VAEDATLVEVNPLVRDPKDQILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgcccgcgagatcgccaccgagatcggccgt
ccggtgatggtcaaggcgcaggtgaaggtcggcgggcgcggcaaggccggcggcgtcaag
tacgcggcgacgcccgacgacgcctacgaacacgccaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctggaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtcgccgcgaccaagccggagcggctggccaaggttccg
gtggacgccgtcaagggtgtcgacctggcgaccgcgcgttccatcgccgagcagggccac
ctgcccgccgaggtgctggacgccgccgccgtcaccatcaacaagctgtgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtcaacccgctggtgcgcgaccccaaagaccaa
atcctggcgctggacggcaaggtcaccctggacgccaacgccgacttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccacggacccgctggagctcaaggccaaggagcac
gacctcaactacgtcaagctggacggctcggtcggcatcatcggcaacggtgcgggcctg
gtgatgtccacgctggacgtcgtcgcctacgcgggcgagaagcacggcggggtcaagccg
gccaacttcctggacatcggtggtggcgcgtcggccgaggtgatggccgccggcctggac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgttcggtggcatcacc
tcctgcgacgccgtcgccaacgggatcgtgaccgcgctgaacatgctcggcgacgaggcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgacgaaggccggcgcatcctg
gcccaagccaaccacccgctggtgatccaggccgagaccatggacgccggtgccgacaaa
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system