KEGG   Mycobacterium intracellulare ATCC 13950: OCU_09540Help
Entry
OCU_09540         CDS       T02158                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCU_09540
Enzymes [BR:mia01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     OCU_09540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942289..943683
Genome map
AA seq 464 aa AA seqDB search
MVTSPSNLPRTVGELRAAGHRERGVKQEIRENLLTALADGPDSAAIWPGILGFDDTVLPQ
LERALIAGHDFVLLGERGQGKTRLLRALVGLLDEWTPVIAGAELGEHPFSPITPESIRKA
ATLGDDLPVEWKHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPR
AHRGIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGR
IITPLKDRFGAEIRTHYPLELDAEVGVIAQEAHLSAQVPDYLMQIIARFARYLRESNSVD
QRSGVSARFAIAAAETVAAAARHRGAILGETDPVARVVDLGTVIDVLRGKLEFESGEEGR
EQAVLEHLLRRATADTASRVLGGIDVGSLVSAVEGGSAVTTGERVSAKDVLAAVPRLPVV
DKIADKLGARSEGERAAALELALEALYLAKRIDKVSEEGQTVYG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacgtcaccgagcaacctgccccgcaccgtcggcgaactgcgcgccgccggtcac
cgtgaacggggagtcaagcaggaaatccgcgaaaatctgctgaccgcactggccgacggg
ccggacagcgcagccatctggcctggcattctgggattcgacgacaccgtcttgccccag
ctcgagcgggctttgatcgcgggtcacgacttcgtgctgctcggcgagcgcggccagggc
aaaacccggctgctgcgtgcgctggtcgggttgctcgatgagtggacgccggtgatcgcc
ggggccgaactgggggagcatccgttctcgccgatcacgccggagtcgatccgcaaggcc
gccaccctgggcgacgacctgccggtggagtggaagcaccgcagcgagcgctacaccgaa
aagctcgccacgcccgacaccagcgtcgccgacctggttggcgacatcgacccgatcaag
gtcgccgagggccgcagcctgggggaccccgagaccatcgcctacgggctgattccgcgc
gcgcaccgcggcatcgtcgcggtcaacgaacttcccgacctcgccgagcgcatccaggtg
tcgatgctcaacgtgatggaggagcgcgacatccaggtccgcggctacacgctgcgcctg
ccgctggacgtgttggtggtcgccagcgccaaccccgaggactacaccaaccgcgggcgc
atcatcaccccgctcaaggaccgcttcggcgcggagatccggacccactatccgctcgag
ctcgacgcggaagtcggggtgatcgcgcaggaggcgcacctgtcggcgcaggtgcccgac
tacctcatgcagatcatcgcccggttcgcccgctacctgcgggagtcgaattccgtcgac
caacgctcgggggtgtcggcgcggttcgccatcgccgccgccgagaccgtcgcggccgcc
gcccgccatcgcggcgcgatcctgggggagacggacccggtggcacgggtggtcgatctg
ggcaccgtgatcgacgtcctgcgcggcaagctggaattcgagtccggcgaggaaggccgc
gagcaggcggtgctcgaacacctgctgcgccgcgcgaccgcggacaccgcgtcgcgggtg
ctgggcggcatcgacgtcggatcgctggtgtcggcggtcgagggcgggtccgcggtgacg
acgggcgagcgggtgtcggcaaaggacgtgctggccgccgtcccgcgcctgccggtggtg
gacaagatcgcggacaagctgggcgcgcggtcggagggcgaacgcgccgccgcgctcgag
ctggcgctcgaggctttgtatctggccaagcgcatcgacaaggtgtccgaggaggggcaa
accgtctatggctaa

DBGET integrated database retrieval system