KEGG   Mycobacterium intracellulare ATCC 13950: OCU_12530Help
Entry
OCU_12530         CDS       T02158                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00300  Lysine biosynthesis
mia01100  Metabolic pathways
mia01120  Microbial metabolism in diverse environments
mia01230  Biosynthesis of amino acids
Module
mia_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCU_12530
Enzymes [BR:mia01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     OCU_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFC42472
UniProt: H8IWI9
Position
1261316..1262380
Genome map
AA seq 354 aa AA seqDB search
MLDLRGDPIALTAALVDIPSESRNEARLADEVEAALRAQTSGFEVVRNGNAVLARTRHQR
PSRVLLAGHLDTVPVAGNLPSRHEGGELHGCGTADMKSGDAVFLHLAATVAEPVHDLTVV
MYDCEEIDAAANGLGRIERELPDWLAADVAILGEPTGGYIEAGCQGTLRVVVSAAGTRAH
SARSWLGDNAIHKLGAVLERLAAYEARSVDIDGCTYREGLSAVRIDGGVAGNVIPDAAAV
TVNFRFAPDRSVPDALQHVHDVLAGLDVHIEQTDAAAGAMPGLSQPAAKALVEAAGGNVR
AKYGWTDVARFAALGIPAVNFGPGDPNLAHRRDERVAVANITAAVDMLRRYLGG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgctggacttacgcggggatccgatcgcgctgaccgcggcgctggtcgacatccccagc
gaatcgaggaacgaggcgcgcctggccgacgaggtcgaggcagcgctgcgcgcgcagacc
tccggcttcgaggtcgtccgcaacggcaacgccgtgttggcgcgaacccgacaccagcgg
ccgtcgcgggtgctgctggccggccacctggacaccgtcccggtggccggaaacctgccc
agccgtcacgagggcggcgagctgcacggctgcggcaccgccgacatgaaatccggggac
gccgtgttcctccatctcgccgccaccgtcgccgaacccgtgcacgatctgacggtggtg
atgtacgactgcgaggaaatcgacgcggcggcaaacggtttgggccgcatcgaacgggaa
ctgccggactggctggccgccgacgtggccatcctgggcgaaccgacgggcggctacatc
gaagccggttgccagggcaccctgcgcgtggtcgtcagcgccgccgggacccgcgcccac
tcggcgcgatcctggttgggggacaacgctattcacaaactgggtgccgtgctcgaacgg
ctggccgcgtacgaggcacgcagcgtggacatcgacggctgcacgtaccgcgagggcttg
tcggccgtgcgcatcgacggcggggtggcgggcaacgtcattcccgatgcggccgcggtg
acggtcaacttccgctttgccccggacaggtcggtgcccgacgcgctgcaacacgtgcac
gacgtgctcgccggactggacgtgcacatcgaacagaccgacgccgcggccggggcgatg
cccgggctgtcccagcccgccgccaaggcgttggttgaggcggcgggcggtaacgtgcgg
gccaagtacggctggaccgacgtcgcgcggttcgccgcgctgggtataccggcggtcaac
ttcggccccggcgacccgaatttggcgcaccggcgcgacgaacgcgtggcggtcgccaac
atcaccgcggcggtggacatgctgcgccgctacctgggcggctag

DBGET integrated database retrieval system