KEGG   Mycobacterium intracellulare ATCC 13950: OCU_12570Help
Entry
OCU_12570         CDS       T02158                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mia00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1267154..1268002
Genome map
AA seq 282 aa AA seqDB search
MSADRALIMAIVNRTPDSFYDRGATFSDEAARAAVHRAVADGADVIDVGGVKAGPGQEVD
ADTEIARLVPFIEWLRDAYPDHVISADTWRSEVAKVACAAGADLINDTWAGVDPALPEVA
AEFGAGLVCSHTGNAQPRTRPFRVNYGTATRGVVDDVIAQVTAAAERAVACGVARDRVLI
DPTHDFGKNTFHGLLLLRHVGDLVDTGWPVLMALSNKDFVGETLGVELTERLEGTLAATA
LAAAAGARMFRVHEVAATRRVLEMVASIQGTRPPTRTVRGLA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagccgatcgcgcgctgatcatggcgatcgtcaaccgcaccccggactcgttctac
gacaggggcgcgaccttcagcgacgaggccgcccgggcggccgtgcaccgggccgtggcc
gacggcgccgacgtcatcgacgtgggcggcgtcaaggccggcccgggccaagaggtcgac
gccgacaccgagatcgcccggctggtgccgttcatcgaatggttgcgcgacgcctatccc
gaccacgtgatcagcgccgatacctggcgctccgaggtcgccaaggtggcctgcgcggcc
ggggcggacctgatcaacgacacctgggccggcgtcgaccccgccctaccggaggtggcc
gcggagttcggggcgggtctggtctgttcgcacaccggcaacgcgcagccgcgcacgcgc
ccgttccgggtgaactacggaaccgccacgcgcggcgtcgtcgacgacgtgatcgcccag
gtcaccgccgccgccgagcgggcggtcgcgtgcggggtggcgcgcgaccgagtactgatc
gacccgacccacgacttcggcaagaacaccttccacgggctgctgctgttgcggcacgtc
ggcgatctcgtcgataccgggtggccggtgctgatggctttgagtaacaaggacttcgtc
ggggagactctgggtgtggaattgaccgagcggctcgagggaacgttggcggccaccgcg
ctggccgcggccgccggtgcgcggatgtttcgcgtgcacgaggtcgccgccacccgccgg
gtgctggaaatggtggcgtcgatccaggggacgcgcccgccgacccgcacggtgaggggg
ctcgcatga

DBGET integrated database retrieval system