KEGG   Mycobacterium intracellulare ATCC 13950: OCU_15060Help
Entry
OCU_15060         CDS       T02158                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00360  Phenylalanine metabolism
mia00362  Benzoate degradation
mia00620  Pyruvate metabolism
mia00621  Dioxin degradation
mia00622  Xylene degradation
mia00650  Butanoate metabolism
mia01100  Metabolic pathways
mia01120  Microbial metabolism in diverse environments
mia01220  Degradation of aromatic compounds
Module
mia_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCU_15060
   00650 Butanoate metabolism
    OCU_15060
  Amino acid metabolism
   00360 Phenylalanine metabolism
    OCU_15060
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCU_15060
   00622 Xylene degradation
    OCU_15060
   00621 Dioxin degradation
    OCU_15060
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OCU_15060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFC42725
UniProt: H8IKW6
Position
complement(1525448..1526380)
Genome map
AA seq 310 aa AA seqDB search
MPSKSSIAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVD
WLLAQSEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRAHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSR
GVETIGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVATYVPG
YRLLNEPQFDDPSIHSGGQALVTTFVEVDGAGDYLPPYAGNLDIMTAAATKVGEEIAKES
LSATAGGAQS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctaagtcgtccatcgccattgtcgggtcggggaacatcagcactgacctgctt
tacaaactgctgcgttcggactggctggaaccgcgctggatggtcggcattgacccggag
agcgagggtttggcccgggcccgcaagctgggtctggagaccacccacgagggtgtggac
tggctgttggcccagtccgagaagcccgacctggtgttcgaggcgaccagcgcctacgtg
caccgcgacgcggcccccaagtacgaggccgccggcatccgggccatcgacctgaccccg
gccgcggtgggccccgcggtgatcccgccggccaacctgcgcgcgcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccaccatcccgatcgtctacgcggtgtcg
cgcgccgtcgccgacctcggcggcgtgccgtacgccgagatcgtcgcctcggtcgcctcg
ctgtcggccggccccggcacccgcgccaacatcgacgagttcaccaagaccaccagccgg
ggtgtggagaccatcggcggcgccaagcgtggcaaggcgatcatcatcttgaatccggcg
gacccgccgatgatcatgcgcgacaccatcttctgcgccatcccggaggacgccgaccgg
gacgcgatcgccaagtcgattcacgacgtggtggccgaggtggcgacctacgtgccgggt
taccggctgctcaacgagccccagttcgatgacccgtcgatccactccgggggccaggca
ctggtcaccacgttcgtcgaagtggatggtgcgggcgactatctgccgccttacgctgga
aatctcgacatcatgaccgccgcggccaccaaagtcggcgaggagatcgccaaggagtcc
ttgagcgcgacggccggaggagcgcaatcatga

DBGET integrated database retrieval system