KEGG   Mycobacterium intracellulare ATCC 13950: OCU_15950Help
Entry
OCU_15950         CDS       T02158                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCU_15950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCU_15950
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OCU_15950
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OCU_15950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618273..1619355
Genome map
AA seq 360 aa AA seqDB search
MSAPRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIAATRLSEKTGCTVHLKVE
GLNPTGSFKDRGMTMAVTDAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDALGAAPDVHALPVGNAGNITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVNGAPV
KNPETIATAIRIGAPASWTAAVDAQRQSNGRFLAATDEEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVDDGWVARGSTVVCTVTGNGLKDPDTALRDMPTVTALPVDPVLVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgcgcaccgccgtccaccaaccctggcccgggctcatcgaggcctaccgg
gaccggttgccggtgggcgacgactggaccccggtcaccctgctcgagggcggcaccccg
ctgatcgcggcgacccgcctgtcggaaaagaccggctgcacagtccatctcaaggtcgag
ggcctcaatcccaccggctccttcaaagaccgggggatgacgatggcggtcaccgatgcg
gtggcgcgcggccaacaggccgtgttgtgcgcctcgaccggcaacacctcggcgtcggcg
gcggcctatgccgcccgcgccgggatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcgcaggcggtgatgcacggcgccaagatcatccagatcgacggc
aacttcgacgactgcctggaactggcccgaaagatggccgccgacttcccgacgatctcc
ttggtcaactcggtcaacccggtgcgcatcgagggccagaagacggccgcgttcgagatc
gtcgacgcgctcggcgcagcgccggacgtgcacgcccttccggtcggcaacgcgggcaac
atcaccgcgtactggaagggatacaccgagtatcaccacgagggcctgatcgaaaagctg
ccgcggatgctgggcacccaggcggccggcgcggcccccctggtgaacggtgcgccggtc
aagaacccggaaacgattgcgaccgcgatccgcatcggcgcgcccgcgtcgtggacggcc
gcggtcgacgcgcagcgccaatccaacggccgcttcctggcggccaccgacgaggagatc
ctggccgcctaccacctggtggccgagtccgaaggtgtcttcgtcgaacccgcctcggcg
gccagcatcgcgggtctgcttaaggccgtcgacgacggctgggtggcccgcgggtcgacg
gtcgtgtgcacggtgacgggcaacgggctcaaggatcccgacacggcactacgggatatg
cccaccgtgaccgcgctgccggttgatccggtcctggtggtcgaaaaactggggctggcg
tag

DBGET integrated database retrieval system