KEGG   Mycobacterium intracellulare ATCC 13950: OCU_21100Help
Entry
OCU_21100         CDS       T02158                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OCU_21100
Enzymes [BR:mia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     OCU_21100
Transfer RNA biogenesis [BR:mia03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    OCU_21100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205351..2206091
Genome map
AA seq 246 aa AA seqDB search
MEAPMNDHDLAARLATDAGQLLLGVRQEFADAEASERKAAGDKRSHDFLMAALAAQRPGD
AVLSEEGADNPVRLRAERVWIVDPLDGTREFSELGRDDWAVHVALWEAGELVAGAVALPA
QGITFATPDIASPPAAPGKPRIVVSRTRPPAIALNVRDALDGVLVEMGSAGAKVASIVQG
LSDVYVHAGGQYEWDSAAPVAVARAAGLHTSRIDGSALAYNQPDPKLPDLVVCRPELAEA
VLAVTG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcgccgatgaatgaccatgacctggccgcgcggttggccaccgacgcgggccag
ctgctgctcggggtccggcaggagttcgccgacgcggaagcgagcgaacggaaagccgcg
ggggacaagcgatcccacgactttctgatggctgcgctcgccgcgcagcgccccggcgac
gcggtgctgtccgaggagggcgccgacaacccggtgcggttgcgcgcggagcgcgtctgg
atcgtcgatccgctggacgggacgcgggagttctccgagctcgggcgcgacgactgggcg
gtgcacgtcgcgttatgggaggccggcgagctggttgccggcgccgtggcgctgccggcg
cagggcatcacgttcgccacgcccgacatcgcgtcgcctccggcggcgccgggcaagccg
cggatcgtggtctcgcgcacccgcccgcccgccatcgcgctgaacgtccgggacgccctg
gacggcgttctggtcgaaatgggttcggccggcgccaaggtggcgtcgatcgtccagggc
ttgtccgatgtgtacgtgcacgccggcgggcagtacgaatgggactccgccgccccggtg
gcggtggcgcgcgccgcggggctgcacacctcccgcatcgacgggtccgccctggcctac
aaccagccggacccgaagctgccggacctcgtggtgtgccgtcccgagctcgcggaagcc
gtactcgcggttaccggctga

DBGET integrated database retrieval system