KEGG   Mycobacterium intracellulare ATCC 13950: OCU_22430Help
Entry
OCU_22430         CDS       T02158                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCU_22430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCU_22430
  Amino acid metabolism
   00310 Lysine degradation
    OCU_22430
Enzymes [BR:mia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OCU_22430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2332073..2333866)
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEVGGELAVIGDEDGGSQAPSQQEPQAQSAPPAQPEAQPEPEPQPQAQPEPQPA
QQSSGGGDATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEIPSPVA
GVLISITAEEDATVPVGGELARIGSGSEAAAPAAPQPPPAPKAEPKPEPAPQPQPQPQPQ
PQAQPKPEPTPAPAPQPKAAPEPKAQPAQAQPADASGDGTPYVTPLVRKLAAENNIDLSS
VTGTGVGGRIRKQDVLAAAERKQQADKAPAAAAAPTPAAGEARKAAPAPTPAPALAHLRG
TTQKASRIRQITANKTRESLQATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLP
FIARAVIDALKIHPNVNASYNEETKEITYFDAEHLGFAVDTEQGLLSPVVHNAGDLSLAG
LARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggcgacacggtcgaactcgacgagccgctcgtcgaggtgtcg
accgacaaggtcgacaccgaaatcccgtcgccggccgcgggtgtgctgaccaagatcgtc
gcccaggaagacgacaccgtcgaggtcggcggcgagctggccgtgatcggcgacgaggac
ggcggatcccaggcgccgagccagcaagagccgcaggcgcagtcggcgccccccgcccag
cccgaggcgcaacccgagcccgagccgcagccccaggcccagcccgagccgcagccggcc
cagcagagctccggcggcggcgacgccaccccggtgctgatgcccgaactgggtgagtcg
gtgaccgagggcaccgtgacccgctggctcaagaaggtcggcgattcggtccaggtcgac
gacgcgcttgtcgaggtgtccaccgacaaggtggacaccgagatcccgtcgccggtggcc
ggtgtgctgatcagcatcaccgccgaggaagacgccaccgtgcccgtcggcggcgagctg
gcccgcatcggcagcggttccgaggccgccgcccccgccgcgccgcagccgccgcccgcg
cccaaggccgaacccaagccggaacccgcgccacaaccgcaaccacaaccacagccccag
ccccaggcgcagccgaagcccgaaccgacgccggcccccgcaccgcaaccgaaggcggca
cccgagccgaaagcccaacccgcacaggcccagccggcggacgcgagcggcgacggcacc
ccctacgtgacgccgctggtgcgaaaactggccgccgagaacaacatcgacctcagttcg
gtcaccggcaccggagtgggcggccgcatccgcaagcaagacgtgctggcggccgccgag
cgcaagcagcaggccgacaaggcgcccgccgccgctgctgctcccacccccgctgccggc
gaggcccgcaaggccgctcccgcgcccaccccggcgccggcgctggcgcacctgcgcggc
accacccagaaggccagccggatccgtcagatcaccgccaacaagacgcgcgaatccctg
caggccacagcccaactcacccagacccacgaggtcgacatgaccaggctggtcgggttg
cgggccagggccaaggcggcgttcgccgaacgcgaaggcgtcaacctgaccttcctgccg
ttcatcgcccgcgcggtgatcgacgccctcaagatccacccgaacgtgaacgcgagctac
aacgaggaaaccaaggagatcacctacttcgacgccgagcacctcggcttcgcggtcgac
accgaacagggtctgctctcccccgtcgtgcacaacgccggcgacctgtcgctggccggg
ctggccagggcgatcgccgacatcgccgcgcgcgcccgctcgggcaacctgaaacccgac
gagctctcgggcggcacgttcacgatcaccaacatcggcagccagggggcgctgttcgac
accccgatcctggtcccgccgcaggccgcgatgctgggcaccggcgccatcgtcaaacgc
ccccgggtgatcgtcgacgaattcggcaacgaatcgatcggtgtccgatcgatctgctac
ctgccgctgacctatgaccaccggctgatcgacggcgcggatgccgggcggttcctgacc
accatcaagcaccggctcgaagagggagcgttcgaggccgacctcgggctctga

DBGET integrated database retrieval system