KEGG   Mycobacterium intracellulare ATCC 13950: OCU_22990Help
Entry
OCU_22990         CDS       T02158                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OCU_22990
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OCU_22990
Enzymes [BR:mia01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     OCU_22990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2391849..2393417
Genome map
AA seq 522 aa AA seqDB search
MADGGGDGVSVPSALRPSAAAGVRLPALAADIGAAPAGDRAVPNLPVTGVTLRAQEVRPG
DLFAALPGSTTHGARYAGDAIERGAVAVLTDAGGVAEMGALGQSVPVLVHPDPRGVLGGL
AATVYGNPSERVTVVGVTGTSGKTTTTYLIESALRAAGHTAGLIGTIGIRIDGADIPSAL
TTPEAPALQAMLAAMAEQGVDTVVMEVSSHALTLGRVDGTRFAVGGFTNLSRDHLDFHPT
MADYFEAKAMLFDPSSPLRARRVVVCVDDDAGRAMAARAGDAITVSAEGRPAHWRATDVA
PMGAAGQRFTAIDPAGARHQLGVRLPGHYNVANCLVALAILDAVGVSPEQASTGLLQARV
PGRMEEIDAGQDFLALVDYAHKPGALRAVLTTLARPDRRLAVVFGAGGERDPGKRAPMGA
TAAELADLVVVTDDNPRGEDPASIRREILAGATESGCAADIVEIADRRDAIRHAVAWAGP
GDVVLIAGKGHETGQSAGGHTRPFDDRVELAQALRDLNGAPR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggaggtggtgacggggtgtcggtgcccagtgcgctgcggcccagcgccgca
gcgggcgtgcgcttgccggcgttggcggctgacatcggagccgcgccggccggcgatcgg
gccgtcccgaacctgccggtcaccggggtcacgctgcgcgcccaggaggtgcggcccggc
gatctgttcgccgcgctgcccggttccaccacccacggcgcgcgttacgccggcgacgcg
atcgaacgcggcgcggtcgccgtgctcaccgacgccggcggggtcgccgagatgggcgcc
ctagggcaatccgtgccggtcctcgttcacccggacccccgcggtgtgctcggcgggctg
gccgccacggtgtacgggaacccgtccgagcgggtgacggtcgtcggcgtcaccggcacg
tccggcaagaccaccacgacgtatctcatcgagtccgcactgcgcgccgccggccacacc
gccgggctgatcggcaccatcgggatccgcatcgacggcgccgacattcccagcgcgctg
accaccccggaggcccccgccctgcaggcaatgctggcggcgatggccgaacagggggtg
gacaccgtcgtcatggaggtctccagtcacgccctgacgctgggccgcgtggacggaacc
cggttcgcggtgggcggtttcaccaacctgtcccgcgaccacctcgacttccacccgacg
atggccgactacttcgaggccaaggcgatgctcttcgacccgagctccccgctgcgggcc
cggcgcgtcgtggtctgcgtcgacgacgacgccgggcgcgccatggccgcccgcgccggc
gacgcgatcaccgtcagcgccgagggccggcccgcccactggcgcgccaccgacgtggcc
ccgatgggcgccgcgggacaacggttcaccgccatcgatcccgccggggcgcgccatcag
ctgggtgttcggctgcccggccattacaatgtcgccaattgccttgtcgcactggctatt
ctggacgcggtcggggtgtccccggagcaggcgtcgacgggcctgctacaggcccgcgtg
ccgggacgcatggaggagatcgacgccggccaggacttcctggcgctggtcgactacgcc
cacaaaccgggcgcgttgcgcgcggtgctgaccacgctggcgcgtccggatcgccggctg
gccgtggtgttcggcgccggcggcgaacgcgacccgggcaaacgggcgccgatgggcgcg
acggcggccgagctggccgatctggtcgtcgtcaccgacgacaacccgcgcggtgaggac
ccggcgtcgattcgtcgcgaaatcctcgccggggcgaccgaaagcggttgtgcggcagac
attgtcgagatcgccgaccgccgcgacgcgatcaggcacgccgtcgcctgggcgggcccg
ggcgacgtcgtgctgatcgccggcaagggccacgaaaccggccagagcgccggcgggcac
acccgccccttcgacgaccgggtcgagctggcgcaggcgctgcgggacctgaacggggca
ccgcgatga

DBGET integrated database retrieval system