KEGG   Mycobacterium intracellulare ATCC 13950: OCU_23510Help
Entry
OCU_23510         CDS       T02158                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mia00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2448342..2449142
Genome map
AA seq 266 aa AA seqDB search
MSHAPDDESDEMTDAALAADLAAEAGELLLKVRDEVGFGYPWALGDAGDSLANDLILRRL
RVERPGDAVLSEEAYDDLSRLQHDRVWIIDPLDGTREFSTPGRDDWAVHIALWQRPSDGQ
REITDAAVSLPARGNIVYRSDTVSAGAARAGVTDTIRIAVSATRPPAVLHRMRQTLPIQP
VAIGSAGAKAMAIIDGDVDAYVHAGGQWEWDSAAPAGVVMAAGMHASRLDGSPMRYNQLD
PYLPDFVMCRAELAPILLGAIRDAWR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccatgcccccgacgacgagtcggacgagatgaccgatgccgcgctggccgccgat
ctcgccgccgaagcgggggagttgttgctgaaggtccgcgacgaggtcgggttcgggtat
ccctgggcgctgggcgacgcgggtgacagcctggcgaacgacctgatcctgcggcggctg
cgcgtcgagcggcccggcgacgcggtgctcagcgaggaggcctacgacgacctgtcccgg
ctgcagcacgaccgggtgtggatcatcgacccgctggacggcacccgcgagttctccacg
ccgggccgcgacgactgggcggtccacatcgcgctgtggcagcgacccagcgatggccaa
cgcgagatcaccgacgcggcggtgtcattgcccgcgcgcggcaacatcgtctaccgcagc
gacaccgtgtcggccggcgccgcccgcgccggcgtcaccgacaccatccgcatcgccgtc
agcgccacccggcccccggcggtcctgcaccggatgcggcagacgctgcccatccagccg
gtcgcgatcggctcggcgggcgccaaggcgatggccatcatcgacggcgacgtcgacgcc
tacgtgcacgccggcggccagtgggagtgggactcggccgccccggccggggtggtgatg
gccgccgggatgcacgcctcgcggctcgacggatcgccgatgcgctacaaccagctcgac
ccgtacctgcccgacttcgtcatgtgccgcgccgagctggcgccgatcctgctgggagcc
atccgcgacgcctggcgctaa

DBGET integrated database retrieval system