KEGG   Mycobacterium intracellulare ATCC 13950: OCU_26010Help
Entry
OCU_26010         CDS       T02158                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00630  Glyoxylate and dicarboxylate metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01200  Carbon metabolism
Module
mia_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_26010
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCU_26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFC43820
UniProt: H8ILB8
Position
complement(2732788..2735076)
Genome map
AA seq 762 aa AA seqDB search
MAIIDKDTQVRPSFDDEVAATQQYFDDPRFSRITRLYTARQVAEQRGTIPTDYTVARNAA
AAFYERLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQQYQRLQMSEKQRAAAPVYDYRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMK
VPGIIVARTDAEAANLLDSRADERDQPFLLGATNLKIPSYKSCFLALVRRFYELGVKDLN
GHLLYALPEGEYAEATAWLERQGIQGLVSDAVNAWREDGQQSIDDLFDQVESRFVAAWED
DAGLMTYGEAVADVLAFAASEGEPADMSAEEWREFAATASLYSARAKAKELGVDPGWDCE
LSKTPEGYYQIRGGIPYAIAKSLAAAPFADLLWMETKTADLDDARQFADAIHAKFPDQML
AYNLSPSFNWDTTGMTDEQMKQFPEELGKMGFVFNFITYGGHQIDGVAAEEFATSLQQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALTASSGRTATTKSMGEGSTQHQHLVQT
EVPKKLLEEWLAMWSENYDLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVVDPIKD
RHGRSILQVRDQNTFAEKLRQKRLMTLIHLWLVHRFKADGVIYVTPTEDNLYQTSKMKSH
GIFSEVYQEVGEIIVAEVNQPRIAELLKPDRVALRKLITKEG
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcgacaaggacacacaagtccggccatcgttcgacgacgaggtcgctgcc
acgcagcaatacttcgacgatccgcgcttttcccggatcacccgcctgtacacggcccgc
caggtagccgagcagcgcggcaccatcccgaccgactacaccgtggcacgaaacgcggcg
gcggccttctacgagcggttgcgcgagctgttcgcccagaagaagagcatcacgacgttc
ggcccgtactcgcccggccaggcggtcgcgatgaagcggatgggcatcgaggggatctat
ctgggcggctgggcgacctcggccaaggggtccaccaccgaagatcccggacccgacctc
gccagctacccgctgagccaggtgcccgacgacgccgcggtgctggtgcgcgccctgctg
accgccgaccgcaaccagcaataccagcgcctgcagatgagcgaaaagcagcgcgccgcg
gcgccggtctacgactaccggccgttcatcatcgccgacgctgataccggccacggcggt
gacccgcacgtgcgcaacctgatccgccggttcgtcgaggtcggcgtgcccggctaccac
atcgaggaccagcgccccggcaccaagaagtgcggccatcagggcggcaaggtgttggtg
ccgtccgacgaacagatcaaacggctcaacaccgcgcgcttccagctcgacatcatgaag
gtgccgggcatcatcgtcgcgcgcaccgacgccgaggccgccaacctgctggacagccgg
gccgacgagcgtgaccagccgttcctgctcggagccaccaacctcaagatcccgtcgtac
aagtcgtgcttcctggcgttggtgcgtcgcttctacgagctgggcgtcaaagacctcaac
ggccacctgctgtacgcgctgcccgaaggggagtacgccgaggccacagcttggcttgag
cgccaagggatccagggcctggtctccgacgccgtcaacgcctggcgcgaggacggtcag
cagtcgatcgacgacctgttcgaccaagtcgagtcgcggttcgtggcggcctgggaggac
gacgccggcctgatgacctacggcgaggccgtcgccgatgtgctcgcgttcgccgccagc
gagggcgaaccggccgatatgagcgccgaggagtggcgagagttcgccgcgaccgcctcg
ctctactcggccagggccaaggcgaaggagttgggcgtcgaccccggttgggactgcgaa
ctttcgaagacgcccgagggctactaccagatccgcggcggcatcccgtacgccatcgcc
aaatcgctggcggccgcgccgttcgccgacctcttgtggatggagaccaagaccgccgac
ctggatgacgcccggcagttcgccgacgccatccacgccaagttccccgaccagatgctg
gcctacaacctgtccccgtcgttcaactgggacaccaccggcatgaccgacgagcagatg
aagcagttccccgaggaactgggcaagatgggtttcgtcttcaacttcatcacctacggc
ggacaccagatcgacggcgtcgccgccgaggagttcgccacctcgctgcaacaggacggc
atgctggcgctggcccgcctgcagcgcaagatgcgcctggtcgaatctccttaccgcaca
ccgcaaaccctcgtcgggggaccgcgcagcgacgccgcgctcacggcctcctcgggccgc
accgccaccaccaagtcgatgggcgaaggctcgacccagcaccagcacctggtgcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgatgtggagcgagaactacgacctc
ggcgagaaactgcgggtgcaactgcggccccgccgcgccggctcggacgtgctcgaactc
ggcatctacgggaacgacgacgagcagctggccaacgtggtcgtcgacccgatcaaggac
cggcacggccgcagcatccttcaggtgcgcgaccagaacaccttcgcggagaagctccgc
cagaagcggctgatgaccttgatccacctctggctggtgcaccgcttcaaggccgacggg
gtgatctatgtgacgccgaccgaggacaacctctatcagacctcgaagatgaaatcccac
ggcatcttcagcgaggtctaccaggaggtcggcgagatcatcgtcgccgaggtgaatcag
ccccgcatcgccgaactgctcaagcccgaccgcgtggcgctgcgcaagctgatcaccaag
gaggggtag

DBGET integrated database retrieval system