KEGG   Mycobacterium intracellulare ATCC 13950: OCU_26010Help
Entry
OCU_26010         CDS       T02158                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCU_26010
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    OCU_26010
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     OCU_26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2732788..2735076)
Genome map
AA seq 762 aa AA seqDB search
MAIIDKDTQVRPSFDDEVAATQQYFDDPRFSRITRLYTARQVAEQRGTIPTDYTVARNAA
AAFYERLRELFAQKKSITTFGPYSPGQAVAMKRMGIEGIYLGGWATSAKGSTTEDPGPDL
ASYPLSQVPDDAAVLVRALLTADRNQQYQRLQMSEKQRAAAPVYDYRPFIIADADTGHGG
DPHVRNLIRRFVEVGVPGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNTARFQLDIMK
VPGIIVARTDAEAANLLDSRADERDQPFLLGATNLKIPSYKSCFLALVRRFYELGVKDLN
GHLLYALPEGEYAEATAWLERQGIQGLVSDAVNAWREDGQQSIDDLFDQVESRFVAAWED
DAGLMTYGEAVADVLAFAASEGEPADMSAEEWREFAATASLYSARAKAKELGVDPGWDCE
LSKTPEGYYQIRGGIPYAIAKSLAAAPFADLLWMETKTADLDDARQFADAIHAKFPDQML
AYNLSPSFNWDTTGMTDEQMKQFPEELGKMGFVFNFITYGGHQIDGVAAEEFATSLQQDG
MLALARLQRKMRLVESPYRTPQTLVGGPRSDAALTASSGRTATTKSMGEGSTQHQHLVQT
EVPKKLLEEWLAMWSENYDLGEKLRVQLRPRRAGSDVLELGIYGNDDEQLANVVVDPIKD
RHGRSILQVRDQNTFAEKLRQKRLMTLIHLWLVHRFKADGVIYVTPTEDNLYQTSKMKSH
GIFSEVYQEVGEIIVAEVNQPRIAELLKPDRVALRKLITKEG
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcatcgacaaggacacacaagtccggccatcgttcgacgacgaggtcgctgcc
acgcagcaatacttcgacgatccgcgcttttcccggatcacccgcctgtacacggcccgc
caggtagccgagcagcgcggcaccatcccgaccgactacaccgtggcacgaaacgcggcg
gcggccttctacgagcggttgcgcgagctgttcgcccagaagaagagcatcacgacgttc
ggcccgtactcgcccggccaggcggtcgcgatgaagcggatgggcatcgaggggatctat
ctgggcggctgggcgacctcggccaaggggtccaccaccgaagatcccggacccgacctc
gccagctacccgctgagccaggtgcccgacgacgccgcggtgctggtgcgcgccctgctg
accgccgaccgcaaccagcaataccagcgcctgcagatgagcgaaaagcagcgcgccgcg
gcgccggtctacgactaccggccgttcatcatcgccgacgctgataccggccacggcggt
gacccgcacgtgcgcaacctgatccgccggttcgtcgaggtcggcgtgcccggctaccac
atcgaggaccagcgccccggcaccaagaagtgcggccatcagggcggcaaggtgttggtg
ccgtccgacgaacagatcaaacggctcaacaccgcgcgcttccagctcgacatcatgaag
gtgccgggcatcatcgtcgcgcgcaccgacgccgaggccgccaacctgctggacagccgg
gccgacgagcgtgaccagccgttcctgctcggagccaccaacctcaagatcccgtcgtac
aagtcgtgcttcctggcgttggtgcgtcgcttctacgagctgggcgtcaaagacctcaac
ggccacctgctgtacgcgctgcccgaaggggagtacgccgaggccacagcttggcttgag
cgccaagggatccagggcctggtctccgacgccgtcaacgcctggcgcgaggacggtcag
cagtcgatcgacgacctgttcgaccaagtcgagtcgcggttcgtggcggcctgggaggac
gacgccggcctgatgacctacggcgaggccgtcgccgatgtgctcgcgttcgccgccagc
gagggcgaaccggccgatatgagcgccgaggagtggcgagagttcgccgcgaccgcctcg
ctctactcggccagggccaaggcgaaggagttgggcgtcgaccccggttgggactgcgaa
ctttcgaagacgcccgagggctactaccagatccgcggcggcatcccgtacgccatcgcc
aaatcgctggcggccgcgccgttcgccgacctcttgtggatggagaccaagaccgccgac
ctggatgacgcccggcagttcgccgacgccatccacgccaagttccccgaccagatgctg
gcctacaacctgtccccgtcgttcaactgggacaccaccggcatgaccgacgagcagatg
aagcagttccccgaggaactgggcaagatgggtttcgtcttcaacttcatcacctacggc
ggacaccagatcgacggcgtcgccgccgaggagttcgccacctcgctgcaacaggacggc
atgctggcgctggcccgcctgcagcgcaagatgcgcctggtcgaatctccttaccgcaca
ccgcaaaccctcgtcgggggaccgcgcagcgacgccgcgctcacggcctcctcgggccgc
accgccaccaccaagtcgatgggcgaaggctcgacccagcaccagcacctggtgcagacc
gaggtgccgaagaagctgctcgaggagtggctggcgatgtggagcgagaactacgacctc
ggcgagaaactgcgggtgcaactgcggccccgccgcgccggctcggacgtgctcgaactc
ggcatctacgggaacgacgacgagcagctggccaacgtggtcgtcgacccgatcaaggac
cggcacggccgcagcatccttcaggtgcgcgaccagaacaccttcgcggagaagctccgc
cagaagcggctgatgaccttgatccacctctggctggtgcaccgcttcaaggccgacggg
gtgatctatgtgacgccgaccgaggacaacctctatcagacctcgaagatgaaatcccac
ggcatcttcagcgaggtctaccaggaggtcggcgagatcatcgtcgccgaggtgaatcag
ccccgcatcgccgaactgctcaagcccgaccgcgtggcgctgcgcaagctgatcaccaag
gaggggtag

DBGET integrated database retrieval system