KEGG   Mycobacterium intracellulare ATCC 13950: OCU_26730Help
Entry
OCU_26730         CDS       T02158                                 

Definition
adhA_1
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OCU_26730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_26730
  Lipid metabolism
   00071 Fatty acid degradation
    OCU_26730
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCU_26730
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCU_26730
   00626 Naphthalene degradation
    OCU_26730
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCU_26730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801282..2802310)
Genome map
AA seq 342 aa AA seqDB search
MASPVTTTAMRAWRVRRPGPMDTGPLEQVTTEVPRPGPSELLVAVRACGVCRTDLHVTEG
DLPVHREQVTPGHEVVGEVVEIGPEAGDEFRVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRSLLRAELPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGARARELALELGAASAQGAADAPPAPLDAAI
LFAPVGDLVLPALQALDRGGTLAIAGIHLSDIPALNYQRHLFQERQVRSVTSNTRADARA
FLDFAGEHHIEVTTPEYPLGQADRALTDLSAGRIAGAAVLLV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccggtgaccaccaccgcaatgcgcgcctggcgcgttcgtcgacccgggccg
atggatactggcccgctcgagcaggtcaccaccgaggtgccgcggccgggcccgtccgaa
ctgctggtggccgtgcgagcgtgcggggtgtgccggaccgacctgcacgtcaccgaaggc
gaccttcccgtccaccgcgagcaggtcacgcccgggcacgaggtggtgggcgaggtcgtc
gaaatcggccccgaggccggcgacgagttccgggtgggggaccgggtgggtatcgcctgg
ctacgccacacctgtggcgtgtgcaagtactgccgccgcggcgacgagaacctctgcccg
aaatcccgctacaccggctgggacgccgacggcggctacgccgaattcgccaccgtcccg
gccgctttcgcgcaccccctgcccggcgggtacagcgacagcgaactcgcaccgttgttg
tgcgcgggcatcatcggttaccgctcgctgcttcgcgccgagctgccgcccggcgggcgg
ctgggcctctacggtttcggcggcagcgcgcacatcaccgcgcaggtcgccctcgcgcag
ggcgcagaggtgcacgtgatgacccgcggagcccgggcccgcgagctggcgttggaactc
ggcgccgcatccgcacaaggcgcggcggatgcgcccccggcgccactggacgccgcgatc
ctgttcgctcccgtcggtgatctggtgctgcccgcgctgcaggcgctggatcgcggtggc
acgctggcgatcgccgggatccacctctcggatatcccggcgctgaactaccagcgtcac
ctgtttcaggaacgccaggtccggtcggtcacctccaacacccgggccgacgcgcgggcc
ttcctcgatttcgcgggcgagcaccacatcgaggtgaccacgcccgaatatcctctcgga
caagccgatcgggcgttgacggatctgagcgccgggcgcatcgcgggcgcggcggtgctg
ctggtgtga

DBGET integrated database retrieval system