KEGG   Mycobacterium intracellulare ATCC 13950: OCU_26980Help
Entry
OCU_26980         CDS       T02158                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mia01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mia00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mia00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2822659..2824827
Genome map
AA seq 722 aa AA seqDB search
MRVARVLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDELQAQIDKWHR
QRVIEPLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVPVLNARFALN
AANARWGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAVPLESGSWAD
ATGLSVEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHIEILIDPDSP
IGKTDAAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLSEDVDKGGK
TFTRVLNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIIDAEGHEVFEGIMDALF
TGLTAIHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPQGTL
KVGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKGTT
WIKAYEDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTA
ATLHAMHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEVDNNCQSILG
YVVRWVAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVRASLERMAP
LVDEQNAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRRREAKARAAQ
SN
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgtcgcccgggtgctttacgacttcgtgaacgaagaggccttgcccggcaccgat
atcgacccggacagcttctgggccggcgtggacaaggtcgtcaccgacctcaccccgaag
aaccaggatctgctgcgccggcgtgacgagctgcaggcccagatcgacaagtggcaccgg
cagcgggtcatcgagccgctcgacatcgacgcctatcgcgagttcctcaccgaaatcggt
tacctgctgcccgaacccgcggatttcacgatcaccacctcgggcgtcgacgacgagatc
accacgaccgcgggcccccagctcgtggtgccggtgctcaacgcccggttcgcgctgaac
gccgccaacgcccggtggggttcgctctacgacgccctgtacggcaccgacgtcatctcg
gaggacgacggcgccgaaaaggggtcgagctacaacaaggtgcgtggcgacaaggtcatc
gcctacgcgcgcaaattcctggacgaggccgtgccgctggaatccggctcgtgggccgac
gcgaccggtctgtccgtcgaggacggccgcctgaaggtcgcgaccgccgacggttccgcc
ggcctggccgacccggacaagttcgccggctacaccggcgagctcggctcccccagctgg
tcggtgctgctggtcaaccacggcctgcacatcgagatcctcatcgatccggactcgccg
atcggcaagaccgacgccgccggcatcaaggacgtgatcctggaatcggccgtgaccacg
atcatggacttcgaggactcggtggccgccgtcgacgccgacgacaaggtgctcggctac
cgcaactggctcggcctgaacaagggcgacctgtccgaggacgtcgacaagggcggcaag
accttcacccgggtgctcaaccaggaccgcacctactccacgcccgacggcgagggcgag
ctgaccctgccgggccgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaac
gacgcgattatcgacgcggagggtcacgaggtgttcgagggcatcatggatgcgctgttc
accgggctgaccgcgattcacgggctcaagacgagtgaggcgaacgggccgctggccaac
agccgcaccgggtccatctacatcgtcaagcccaagatgcacgggcccgacgaggtcgcg
ttcacctgcgagctgttcagccgggtcgaagacgtcctcgggctgccgcagggcaccctc
aaggtcggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggcctgcatcaag
gccgcggccgaccgggtggtgttcatcaacaccggcttcctcgaccgcaccggcgacgag
atccacacctcgatggaggcgggtccgatgatccgcaagggcgcgatgaagggcaccacc
tggatcaaggcctacgaggacgccaacgtcgacatcggcctggccgccgggttcaagggc
aaggcgcagatcggcaagggcatgtgggcgatgaccgaactgatggccgacatggtcgag
cagaagatcggccagcccaaggccggagccaccaccgcgtgggtgccctcgccgacggcg
gccaccctgcacgcgatgcactaccactacgtcgacgtgggcgccgtgcaggaggagctg
gcgggcaagaagcgcaccaacatcgacgagttgctgaccatcccgctggccaaggaactg
gcctgggctcccgaggagatccgcgaggaggtcgacaacaactgccagtccatcctcggc
tacgtggtgcgctgggtcgcccagggcgtcggctgctcgaaggtgcccgacatccacgac
gtggcgctcatggaagaccgtgcgacactgcggatttcgagtcagctgctggcgaactgg
ctgcgccacggtgtgatcaccgaggaggacgtgcgggccagcctcgagcggatggccccg
ctggtggacgagcaaaacgccaaggatgcggcgtatttgccgatggcgcccaacttcgac
gacagcctggcgttcctggcggcgcaggacctcatcctgaccggaacgcagcagcccaac
ggctacaccgagccgatcctgcaccgccgtcggcgcgaggccaaggcgcgcgccgcgcag
tcgaattga

DBGET integrated database retrieval system