KEGG   Mycobacterium intracellulare ATCC 13950: OCU_27530Help
Entry
OCU_27530         CDS       T02158                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mia00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2884490..2886673
Genome map
AA seq 727 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGRRVRVSEATLKAVLAALGVAAGDEQERNLALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLALEDGTVRGDVAQVDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRGSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPPGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
EEPRSAGRELSYAAFRDREGRALDDFATWCALAEQYGDDWHRWPEALQHPDASGVADFVE
KHSDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGAPPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDSLGLLTRP
VAEELESDRAELAAWLAELRRVGLLDEGEDDPQQVVLALYKYLGRTPSRLLGLALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRDVLLEDVFTDPRAATLAEAVRAAIAPAASESSE
SVQSAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcaccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcaggcgggtgcgggtgtctgaggcgacgctcaaggccgtgctg
gccgcgctcggcgtcgcggccggcgacgaacaggaacgcaacctcgcgctcaccgccaag
ctgaggtcgcactgggcgcggcgactgccggcgaccatcgtcggccgcaccggtgagcag
atccggttttgggcccacgtcacccacggtgctcccgccgaggtgtggttggcgctcgag
gacggcacggtgcgcggcgacgtcgcgcaggtcgacaacttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgacctgccgctggggtat
caccgggtgcacctgcggtccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggcggttcag
ctctacagcgtgcggtcccgggggtcctggggcgtcggggatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattacctcctggtcaatccgctgcat
gcggcggcgcctccgggtccgaagggccggatggagccgtcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaggaaccgcggtcggcgggccgggaactgtcctacgcggcgttccgcgaccgggagggc
cgcgcactcgacgacttcgcgacctggtgcgcgctggccgaacaatacggcgatgactgg
catcgttggcccgaagcgctgcaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattccgacaccgtcgatttccaccgctggttgcaatggcaaatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggcgacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggggcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccgtttcgcgcgttgatc
cgcgcggtactgcggcacgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggtgcaccaccaaccgagggcacctacgtccgctacgaccac
gaagccatgatcggcatcgtcgccctggaggcacaccgggccggcgcggtggtggtgggc
gaggacctcggcacggtcgagccgtgggtgcgtgactacctgttgttgcgggggctgctg
ggcacgtcgatcctctggttcgagctggaccgcgacgggaacggcggaccactgccggcg
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgacggcc
ggctacctggcgggcgaccatgtgcggctgcgtgactcgctgggattgctgacccggccc
gtcgccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgc
cgggtggggctgctcgatgaaggcgaagacgacccgcagcaggtcgtcctggcgctgtac
aagtacctgggccggacgccgtcgcggctgctggggctggcgctcaccgacgccgtcggt
gaccgtcgcacccagaaccagcccggcactacggacgaataccccaactggcgggtcccg
ctgaccggtccggacgggcgcgacgtgctgctcgaagacgtgttcaccgacccccgggcc
gccacgctggccgaggccgtgcgcgccgcgatcgccccggccgcctcggaaagctcggag
agcgttcaaagcgcggcccgctga

DBGET integrated database retrieval system