KEGG   Mycobacterium intracellulare ATCC 13950: OCU_29030Help
Entry
OCU_29030         CDS       T02158                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCU_29030
Enzymes [BR:mia01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     OCU_29030
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OCU_29030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3068937..3069686
Genome map
AA seq 249 aa AA seqDB search
MDLKRRIPLLRWSVWRMVVGNRNITTTGQIGDGREAAAVEYVLRNARAGDVDDVLTTIDK
FAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAKVFSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALAEHGFAAGALDFVFLDHDKDAYL
DDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLEYQSLVSD
LVLESEYLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaagcgacggatacccctgctgcggtggtcggtctggcggatggtcgtcggg
aatcgcaacatcaccacgacgggccagatcggcgacgggcgcgaagccgccgccgtcgaa
tacgtgctgcggaacgcccgggccggcgacgtcgacgacgtgctgacgaccatcgacaag
ttcgcctacgagaagtcgatgttgatcaacgtcggcgacgagaagggactgctgctcgac
gccgcggtgcggcgcgccgatccggcgctggcgctcgaattgggcacctactgcggctac
ggcgcgctgcgcatcgcccgggccgcgccgaaggccaaggtgttctcggtcgaactcgcc
gaggccaacgccgccaacgcccgccagatctgggcgcatgccggcgtggccgaccgtgtg
acgtgtgtggtcggcaccatcggcgacggcggccgcaccctggatgcgctggccgaacac
gggtttgccgctggcgcactcgatttcgtgttcctcgatcacgacaaggacgcctacctc
gacgacctgaagagcatcctggatcggggctggctgcatcccggctcgatcgtggtcgcc
gacaatgtgcgggtgccgggcgcaccgaagtaccgcgggtacatgcaccggcatcagggc
acgcggtggaataccgtcgagcacaagacccacctcgagtaccagtcgttggtgtccgac
ctggtgctggagtccgaatacctgggctga

DBGET integrated database retrieval system