KEGG   Mycobacterium intracellulare ATCC 13950: OCU_30060Help
Entry
OCU_30060         CDS       T02158                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCU_30060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCU_30060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCU_30060
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCU_30060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3198414..3199229)
Genome map
AA seq 271 aa AA seqDB search
MTVKQSEASRLGPIFDVCRDDGRAALIGYLPTGYPDVTTSVHAMVALVESGCDIVEVGVP
YSDPGMDGPTIVKATEAALHGGVRVRDTLAAVEAISAAGGHAVVMTYWNPVLRYGIDAFA
RDLASAGGYGLITPDLIPDEAGQWLAASEEHRLDRIFLVAPSSTPQRLAMTVEASRGFVY
AASTMGVTGARDVVSNAAPELVGRVKEISDIPVGVGLGVRSGEQAAQIGGYADGVIVGSA
LVSALGDGGLTALRALTEELAAGVRQRAAAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagcagagcgaggccagcaggctcgggccgatcttcgacgtgtgccgcgac
gacggtcgcgccgcgctgatcggctatctgcccaccgggtacccggatgtgacgacgtcc
gtgcacgcgatggtcgccctggtcgaatccggttgcgacatcgtcgaggtcggggtgccc
tattcggatcccggcatggacggcccgaccatcgtcaaggccaccgaggccgcgctgcac
gggggagtgcgcgtccgcgacaccctggccgcggtcgaggcgatcagcgccgccgggggc
cacgccgtggtgatgacctactggaaccccgtgttgcgctacggaattgacgccttcgcc
cgcgacctggcatcggccggcgggtacggcctgatcactccggacctcatccccgacgaa
gccgggcagtggttggcggcgtccgaggagcatcggttggaccggatatttctggtggcg
ccctcctcgacgccgcagcgcttggcgatgacggtcgaggcgtcccgcggatttgtctac
gcggcgtcgacgatgggcgtcacgggagcacgcgacgtggtgtccaatgccgcgcccgaa
ttggtgggcagggtcaaggagatatcggacatccccgtcggtgtcgggctgggggtgcgg
tcgggtgagcaagccgcccagatcggcggctacgccgacggtgtcattgtcggttccgcg
ctggtgtcggcgctgggggacgggggtttgaccgcattgcgcgcactcactgaggaactc
gccgccggtgtacgtcaaagggcggccgcgtcgtga

DBGET integrated database retrieval system