KEGG   Mycobacterium intracellulare ATCC 13950: OCU_30070Help
Entry
OCU_30070         CDS       T02158                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCU_30070
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCU_30070
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCU_30070
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     OCU_30070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3199226..3200488)
Genome map
AA seq 420 aa AA seqDB search
MMVDLSRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTAAYEKERVN
QDFLDTLDYLQAHYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALLA
QRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVVS
VQSGSRTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIIGLEARAQIQA
QAGRLPDAVLACIGGGSNAIGIFHPFIDDPGVRLIGFEAAGDGVETGRHAATFSGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLRESGRAEYRPITDSEAMEAFRT
LCRTEGIIPAIESAHAVAGALKVAPELGKAAIIVVNLSGRGDKDVETAAQWFGLLGSSDR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtggatctgtcccgcccggaccttccgcttccgagcgcagccatcgccgaaccc
acccgccacgaacccgatgcgggtggccatttcggtgtgtacggcggccgctacgtcgcc
gaggcgttgatggccgtgatcgaagaggtcaccgcggcctacgagaaggagcgcgtcaac
caggatttcctggacacgctggactatctgcaggcgcattacgcggggcggccgtcaccg
ctgtatgaggcgccgcggctgtccgagcaggccggcgcccgcatcttcctcaagcgagaa
gacctgaaccacaccggttctcacaagatcaacaacgtgctcggccaggcgctgctcgct
cagcggatgggcaagaagcgggtgatcgccgagaccggggccggtcagcacggcgtggcg
accgccaccgcgtgcgccctgctcggcctggagtgtgtgatctacatgggcgccgtcgac
accgaacgccaggcgctcaacgtggcccggatgcgcttgctgggagccacggtcgtctcg
gtccagagcggttcgaggacgctcaaggacgccatcaatgaagcgttccgggattgggtt
accaatgccgacaacaccttctactgcttcggcacggcggcggggccccatccctttccc
gccatggtgcgcgactttcagcgcatcatcggcctcgaggcgcgcgcccagatccaggcg
caggcgggccggctgcccgacgcggtgctggcctgcatcggtggcggatcgaacgccatc
ggcatcttccacccgttcatcgacgatcccggcgtgcggctgatcggcttcgaggcggcc
ggcgacggcgtcgaaaccggaaggcacgccgcgaccttcagcggcggttcccccggggcg
ttccagggatcgttctcctacctgctgcaggacgaggacgggcagaccatcgaatcccat
tccatctcagcgggtctcgactacccgggggtgggtccggaacacgcgtggctgcgcgag
agcggacgcgccgagtaccggcccatcaccgactccgaagcgatggaggcattccgcacc
ctgtgccgcaccgaggggatcatccccgccatcgaatccgcgcacgcggtggccggggcc
ctgaaggtggcccccgaattggggaaggccgcgatcatcgtggtgaacctgtccgggcgt
ggagacaaggacgtcgagacggccgcgcagtggttcgggctgttgggatccagcgaccga
tga

DBGET integrated database retrieval system