KEGG   Mycobacterium intracellulare ATCC 13950: OCU_30080Help
Entry
OCU_30080         CDS       T02158                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01130  Biosynthesis of antibiotics
mia01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCU_30080
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     OCU_30080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh QRPTase_C PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFC44227
UniProt: H8IQM8
Position
complement(3200559..3201362)
Genome map
AA seq 267 aa AA seqDB search
MLDSILEGVRADVAAREALISLSEIKAAAAAAPPPRDVMAALREPGIGVIAEVKRASPSA
GSLATIADPAKLARAYEDGGARIISVLTEERRFHGSLDDLDAVRAAVSIPILRKDFVVQP
YQIHEARAHGADMLLLIVAALEQSALVSMLDRTESLGMTALVEVHTEEEADRALKAGANV
IGVNARDLATLAVDRDCFARIAPGLPSNVIRIAESGVRGTADLLAYAGAGADAVLVGEGL
VKSGDPRAAVADLVTAGTHPSCPKPSR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgactccatcctcgagggagtccgggccgacgttgccgcgcgcgaagccctcatc
agcctgtccgagatcaaggccgccgcggcggccgcgccgccgccccgcgacgtgatggcc
gccctgcgcgagcccggaatcggcgtcatcgccgaagtcaagcgcgccagcccgtcggcg
ggttccctggcgaccattgccgatccggccaaactggccagggcgtacgaggacggcggc
gcgcgcatcatcagcgtcttgaccgaggagcgccgctttcacggttcgctcgacgatctc
gacgcggttcgggcggcggtctcgataccgattttgcgcaaagactttgtggtgcagccc
tatcagatccacgaagcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcg
ctggagcagtcggcgttggtgtcgatgctggaccgcaccgaatcgctgggcatgacggca
ctcgtcgaggtgcacaccgaagaggaggccgaccgcgcgctcaaggccggggccaacgta
atcggcgtcaacgcccgcgatctggccacgctggcggtggaccgggattgcttcgcgcgc
atcgctcccgggctgcccagcaacgtgatcaggatcgccgaatccggtgtgcgcggtacc
gcagacctgctggcgtacgccggtgcgggtgccgacgccgtgttggtgggcgaaggtctg
gtcaaaagtggtgacccgcgcgccgcggtcgccgatctggtcaccgcgggcacccatccg
tcctgtccgaaaccttctcgctag

DBGET integrated database retrieval system