KEGG   Mycobacterium intracellulare ATCC 13950: OCU_30200Help
Entry
OCU_30200         CDS       T02158                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00340  Histidine metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01230  Biosynthesis of amino acids
Module
mia_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    OCU_30200
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     OCU_30200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFC44239
UniProt: H8IRB8
Position
complement(3210536..3211939)
Genome map
AA seq 467 aa AA seqDB search
MDTVSTIRPSPMARIDLRGAELTAARLRAALPRGGADVEAVLPKVRPIVQAVAERGAEAA
LEFGESFDGVRPPAVRVPAEALEKALAELDAAVAEALRVMIERTRAVHADQRRTDVTTTL
GPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLVVASPPQAQFGGLP
HPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRARSASSPGADAELA
PVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADNTADPAHVAADMISQAEHDE
MAGSVLVTPSEDLAAATDKELAAQLRTTVHRERVTAALGGRQSAIILVDDVDAGVKVVNA
YAAEHLEIQTADAASVAGRIRAAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVITLAEAEDLPAHGEAVRRRFER
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtgagcaccatccgaccgtcgccgatggcccgtatcgacctgcggggcgcg
gaattgacggctgcccgtttgcgggcggcgctgccgcgtggcggtgccgacgtggaggcg
gtgctgcccaaggtgcgcccgatcgtgcaggccgtcgcggagcgcggcgccgaggccgcc
ctcgaattcggggagtccttcgacggggtgcggcccccggccgtccgggtgcccgcggag
gcgctcgagaaagccctcgccgaactcgacgcggcggtcgccgaggccctgcgcgtgatg
atcgagcgcacccgcgcggtgcacgccgaccagcgccgcaccgacgtgacgacgacgctc
ggcccgggcgcgacggtcaccgagcggtgggtaccggtcgagcgggtgggcctctacgtg
cccggcggcaacgccgtctacccgtccagcgtcgtgatgaacgtggtgccggcgcaggcc
gccggcgtcgcctcgctggtggtggccagcccgccgcaggcccagttcggcggcctgccg
cacccgaccatcctggccgcggcccggctgctgggcgtcgacgaggtgtgggccgtcggc
ggcgcgcaggccgtcgcgctgctggcctacggcggcaccgataccggggccgaatggccc
ggcttctcctcggatcgcgcacgatccgcatcgtcgccgggggcagacgccgagttggcg
cccgtcgacatgatcaccgggccgggcaacatctacgtcaccgccgccaagcggctgtgc
cgttcgcgggtcggcatcgacgccgaggccgggccgacggagatcgcgatcctggccgat
aacaccgccgaccccgcgcacgtggccgccgacatgatcagccaggccgaacacgacgaa
atggccgggagcgtgctggtgacccccagcgaggacctggccgcggccaccgacaaggaa
ctggccgcccagttgcggacgaccgtgcaccgcgagcgggtgaccgccgccctgggcggg
cgccagtcggcgatcatcctcgtcgacgacgtggacgccggcgtcaaggtcgtcaacgcc
tacgccgccgaacacctggagatccagaccgccgacgcggcgagcgtggccgggcgaata
cgcgcggcgggagccattttcgtcggcccgtatgcgccggtgagcctcggcgactactgc
gccggatccaatcacgtcctgccgaccgccggctgcgcgcggcattccagcggcctgtcc
gtgcagaccttcctgcgcggcatccacgtcgtcgactacaccgaggcggcgctcaaagac
gtgtccgggcacgtgatcacgctcgccgaggccgaggacctgccggcgcacggcgaggcg
gtacggcggaggttcgagcgatga

DBGET integrated database retrieval system