KEGG   Mycobacterium intracellulare ATCC 13950: OCU_31800Help
Entry
OCU_31800         CDS       T02158                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCU_31800
   01230 Biosynthesis of amino acids
    OCU_31800
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_31800
   00051 Fructose and mannose metabolism
    OCU_31800
   00562 Inositol phosphate metabolism
    OCU_31800
Enzymes [BR:mia01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCU_31800
Exosome [BR:mia04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCU_31800
  Exosomal proteins of bladder cancer cells
   OCU_31800
  Exosomal proteins of melanoma cells
   OCU_31800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3434868..3435653)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDAGAYTGEISGAFLAKLGCTFVVVGHSERRTYHHEDDTVVAAKTAA
ALKHELTPIVCIGEHLEVREAGNHVIHCEEQLRGSLAGLSTEQIGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctgacctacggcgggcaggacctgtcccagcacgacgccggcgcctacacc
ggcgagatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tccgagcgcaggacctaccaccacgaggacgacaccgtcgtcgccgccaagaccgccgcg
gcgctcaagcacgaactgaccccgatcgtctgcatcggcgagcacctcgaggtgcgcgag
gccggaaaccacgtcatccactgcgaagagcagctgcgggggtcgctggccgggctgtcc
accgaacagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgcgcggcgatccgcaaggagttggcg
tcgctcgcctcgccccaggtcgccgactcggtgcgggtgctctacggcggctcggtcaac
gccaagaacgtcggcgagctcgtcgcccaggacgacatcgacggcggcctggtcggcggc
gcgtcgctggacggcgagcaattcgccacgctggcggccatcgccgccggtgggcctctt
ccgtga

DBGET integrated database retrieval system