KEGG   Mycobacterium intracellulare ATCC 13950: OCU_32770Help
Entry
OCU_32770         CDS       T02158                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCU_32770
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCU_32770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3535481..3536278)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSDLMRRAAEQLTTLQSKDAADAPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDGIANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLIVSHMDTTPLYGDCAFLEKWPGVPVGNEEGEIISAALGDK
KAVLLAHHGHVIAGASVEEACSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatccgacttgatgcgccgcgcggccgagcagttg
acgacccttcaatccaaggacgccgccgatgcgccgctgaccacccgccagaagctcgcc
ctgacgtgccgcgccctgttcgacgccgggcacgattccgggttggccgggcagatcacc
gcccgcgccgagcgggacggcacctactacacccagcggctcggtctgggcttcgacgag
atcaccgacgccaacctgcttttggtcgacgaggacctcaacgtccttgagggagacgga
atcgccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgatgtgcaa
tgcatcgtgcacacgcacgcgttccacgtggccgcgctgtcgatgctggaagttccgctg
atcgtgtcccacatggacaccacgccgctctacggcgactgcgcgttcctggagaaatgg
cccggcgtgccggtcggcaacgaggagggggagatcatctccgccgcgctgggggacaag
aaggcggtcctgctggcccaccacggccacgtcatcgccggcgccagcgtcgaggaggcg
tgctcgttgggcatcctcatcgagcgcgccgcgaaactgcagctggccgcgatggccgcc
ggcaccgtcaaagagctacccgaggagctggcccgcgaggcccacgactggacactgtcg
ccgcagcgcagccgcgccaacttcgcctactacgcccgccgggccctggcccggcacccg
gacgcgctgaccagctaa

DBGET integrated database retrieval system