KEGG   Mycobacterium intracellulare ATCC 13950: OCU_32770Help
Entry
OCU_32770         CDS       T02158                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00051  Fructose and mannose metabolism
mia01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    OCU_32770
Enzymes [BR:mia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     OCU_32770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFC44496
UniProt: H8IU36
Position
complement(3535481..3536278)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSDLMRRAAEQLTTLQSKDAADAPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDGIANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLIVSHMDTTPLYGDCAFLEKWPGVPVGNEEGEIISAALGDK
KAVLLAHHGHVIAGASVEEACSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatccgacttgatgcgccgcgcggccgagcagttg
acgacccttcaatccaaggacgccgccgatgcgccgctgaccacccgccagaagctcgcc
ctgacgtgccgcgccctgttcgacgccgggcacgattccgggttggccgggcagatcacc
gcccgcgccgagcgggacggcacctactacacccagcggctcggtctgggcttcgacgag
atcaccgacgccaacctgcttttggtcgacgaggacctcaacgtccttgagggagacgga
atcgccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgatgtgcaa
tgcatcgtgcacacgcacgcgttccacgtggccgcgctgtcgatgctggaagttccgctg
atcgtgtcccacatggacaccacgccgctctacggcgactgcgcgttcctggagaaatgg
cccggcgtgccggtcggcaacgaggagggggagatcatctccgccgcgctgggggacaag
aaggcggtcctgctggcccaccacggccacgtcatcgccggcgccagcgtcgaggaggcg
tgctcgttgggcatcctcatcgagcgcgccgcgaaactgcagctggccgcgatggccgcc
ggcaccgtcaaagagctacccgaggagctggcccgcgaggcccacgactggacactgtcg
ccgcagcgcagccgcgccaacttcgcctactacgcccgccgggccctggcccggcacccg
gacgcgctgaccagctaa

DBGET integrated database retrieval system