KEGG   Mycobacterium intracellulare ATCC 13950: OCU_33020Help
Entry
OCU_33020         CDS       T02158                                 

Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCU_33020
Enzymes [BR:mia01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OCU_33020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3562535..3563134)
Genome map
AA seq 199 aa AA seqDB search
MIAAVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTEARLITAMIVREDSMTLY
GFTDTDTRDLFLTLLSVSGVGPRLAMATLAVHDAGALRRALHDGDVAALTRVPGIGKRSA
ERMVLELRDKVGAAGAGAAPAGAALNGHAVRGPVIEALVGLGFAVKQAEEATDKVLAAEQ
DATTSGALRAALSLLGKSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcggtgcgcggcgaggtgctcgaggtggcgctcgaccatgcggtgatcgag
gccgccggcgtcggctaccgggtgaacgcgacgccgtcgacgctgtccacgctgcggacc
gggaccgaggcgcggctgatcaccgcgatgatcgtccgcgaggattcgatgacgctgtac
ggcttcaccgacaccgacacccgcgacctgtttttgaccctgctgtcggtgtcgggggtc
gggccccggctggcgatggcgaccctggccgtgcacgacgccggcgcgctgcgccgggcg
ctgcacgacggcgacgtcgccgcgctgacccgggtgcccgggatcggcaaacgcagcgcc
gaacggatggtcctggagctgcgggacaaggtgggcgccgccggtgcgggcgcggccccc
gcgggcgccgcgctcaacggccacgcggtccgcgggccggtgatcgaggccctggtgggc
ctcgggttcgccgtcaagcaggccgaggaagccaccgacaaggtgctggccgccgagcag
gacgcgaccacctccggtgcgctgcgcgccgccctgtcgctgctgggcaagtcccgatga

DBGET integrated database retrieval system