KEGG   Mycobacterium intracellulare ATCC 13950: OCU_34070Help
Entry
OCU_34070         CDS       T02158                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00071  Fatty acid degradation
mia00280  Valine, leucine and isoleucine degradation
mia00281  Geraniol degradation
mia00310  Lysine degradation
mia00360  Phenylalanine metabolism
mia00362  Benzoate degradation
mia00380  Tryptophan metabolism
mia00410  beta-Alanine metabolism
mia00627  Aminobenzoate degradation
mia00640  Propanoate metabolism
mia00650  Butanoate metabolism
mia00903  Limonene and pinene degradation
mia00930  Caprolactam degradation
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01212  Fatty acid metabolism
Module
mia_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCU_34070
   00650 Butanoate metabolism
    OCU_34070
  Lipid metabolism
   00071 Fatty acid degradation
    OCU_34070
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCU_34070
   00310 Lysine degradation
    OCU_34070
   00360 Phenylalanine metabolism
    OCU_34070
   00380 Tryptophan metabolism
    OCU_34070
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCU_34070
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCU_34070
   00281 Geraniol degradation
    OCU_34070
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCU_34070
   00627 Aminobenzoate degradation
    OCU_34070
   00930 Caprolactam degradation
    OCU_34070
Enzymes [BR:mia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCU_34070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFC44626
UniProt: H8IV56
Position
3647124..3647945
Genome map
AA seq 273 aa AA seqDB search
MPVSQPPANYDEFPSLRCELGENGVLTLVLDSPGLNSVGPQMHRDLADIWPVIDRDPAVR
VVLVRGEGKAFSSGGSFDLIAETIGEYEGRIRIMREARDLVHNMINCDTPVVSAIRGPAV
GAGLVVALLADISVAGRTAKLIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCETLL
GEEAERIGLVSTCVDDDDVLSTATRIAENLAQGAQNAIQWTKRSLNHWYRMMGPTFETSV
GLEFLSFSGPDVQEGLAAHREKRPARFTGGSAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcagccagcccccagccaactacgacgagttccccagcctgcggtgcgagctc
ggtgagaacggcgtgctgacgctggttctcgactccccggggctgaattcggtgggcccg
cagatgcatcgcgacctcgccgacatctggccggtgatcgatcgcgacccggccgtgcgc
gtcgtcctggtccgcggcgagggcaaggccttttcctccggcggcagcttcgacctgatc
gccgagaccatcggcgagtacgagggccggatccgcatcatgcgcgaagcccgcgacctg
gtgcacaacatgatcaactgcgacaccccggtcgtgtcggcgatccggggaccggcggtg
ggtgcgggcctggtggtggcgctgctggccgacatctcggtggcgggccggaccgcgaag
ctgatcgacgggcacaccaagctcggcgtggccgccggcgaccacgccgcgatctgctgg
ccgctgctggtcggcatggccaaggccaagtactacctgctgacctgcgaaaccctgctc
ggcgaggaggccgagcggatcggcctggtctccacctgcgtcgacgacgacgacgtcctg
tccaccgccacccggatcgccgagaacctggcgcagggcgcgcagaacgccatccagtgg
accaagcgcagcctcaaccactggtaccgcatgatgggccccaccttcgagacctcggtg
ggcctggaattcctcagcttcagcggccccgacgtgcaggaaggcctggccgcccaccgc
gagaagcgccccgcccggtttaccggcggatctgccacctga

DBGET integrated database retrieval system