KEGG   Mycobacterium intracellulare ATCC 13950: OCU_34260Help
Entry
OCU_34260         CDS       T02158                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00010  Glycolysis / Gluconeogenesis
mia00520  Amino sugar and nucleotide sugar metabolism
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01120  Microbial metabolism in diverse environments
mia01130  Biosynthesis of antibiotics
mia01200  Carbon metabolism
Module
mia_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCU_34260
   00520 Amino sugar and nucleotide sugar metabolism
    OCU_34260
Enzymes [BR:mia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     OCU_34260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFC44645
UniProt: H8IVW8
Position
3664387..3665196
Genome map
AA seq 269 aa AA seqDB search
MTSTDSTTDTPGAAPADGTHERRGFGIDVGGSGIKGGIVDMDTGLLIGERVKLLTPQPAT
PSAVAKTIAAVVNEFGWTGPLGVTYPGVVTHGVVQTAANVDKSWIGVNARDIISAELDGQ
DVTVLNDADAAGLAEEHYGAGRNQTGLVILLTFGTGIGSAVIHNGTLIPNTEFGHLEVGG
KEAEKQAASSVKEKKGWSYEKWTKHVTEVLVSIENAMWPDLFIAGGGISRKADKWLPLLE
NRTPVVAAALLNTAGIVGAAMAATSDVTH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgactcgaccacggacacgcccggcgcagcaccggccgacggcacacat
gaacgccgcggcttcggcatcgacgtcggcggcagcggcatcaagggcggcatcgtcgac
atggacacggggttgttgatcggcgaacgggtcaaactgctgaccccgcaacccgcgacg
ccgtcggcggtcgccaagaccatcgccgcggtcgtcaacgaattcgggtggaccgggccc
ctcggcgtgacctaccccggggtggtcacgcacggtgtggtgcaaaccgccgccaacgtg
gacaagtcctggatcggggtcaacgcccgcgacatcatcagcgccgagctggacggtcag
gacgtgacggtcctcaacgatgccgacgcggccgggctggccgaggagcactacggggcg
ggcaggaatcagacgggcctggtgattctcttgacgttcggcaccggtatcggctcggcg
gtcatccacaacggcacgctgatccccaacaccgaattcgggcacttggaggtcggcggc
aaggaagccgagaaacaagccgcctcctcggtgaaggaaaagaagggctggtcctacgaa
aaatggaccaaacacgtcaccgaggtgctggtgagcatcgagaacgcgatgtggccggac
ctgttcatcgccgggggcgggatcagccgcaaggccgacaagtggctgccgctgctcgaa
aaccgcaccccggtggtggccgcggccctgctcaacacggccgggatcgtcggcgcggcg
atggccgccacctcggacgtgacccactga

DBGET integrated database retrieval system