KEGG   Mycobacterium intracellulare ATCC 13950: OCU_34650Help
Entry
OCU_34650         CDS       T02158                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mia00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3699841..3700272
Genome map
AA seq 143 aa AA seqDB search
MTELTGTTVANTRTVEGFLNALQDADYEAADAALADDLVYENVGLPTIHGRARAMKLFRQ
MEGRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWVCGVFEVHNGRITLWRDYFDF
FDMLKATARGLAALVVPSLKAAF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgactgggacaaccgtggcgaacacccgcacggtcgagggattcctgaac
gcgctgcaggacgccgattacgaggccgccgatgccgctttggccgacgacctcgtctac
gaaaacgtcggcctgcccaccatccatggccgcgccagggccatgaagctgtttcgccag
atggagggccgcgcggccttcgaggtgaagatccaccgcatcgcggccgacggcggcgcg
gtgctcaccgaacgcaccgacgcgctgatcttcggccccctgcggctgcagttctgggtg
tgcggcgtgttcgaggtgcacaacgggcgaatcacgctgtggcgggactactttgacttc
ttcgacatgctcaaggccaccgcgcgcggcctggcggcgctggtggtgccgtcgctgaaa
gcggcgttctga

DBGET integrated database retrieval system