KEGG   Mycobacterium intracellulare ATCC 13950: OCU_34810Help
Entry
OCU_34810         CDS       T02158                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mia00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mia00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3714481..3714966)
Genome map
AA seq 161 aa AA seqDB search
MGLVWAQSTSGVIGRGGGIPWNVPEDLARFKEVTIGHTVVMGRRTWDSLPAKVRPLPGRR
NVVLSREDGFAADGAQVVGSLDAAFARAEGEPAVWVIGGGQVYLAALPYATRCEVTEIEL
DLRRDDDDALAPALDDTWVGETGEWQASRSGLRYRFHSYRR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctggtgtgggcccagtcgacctccggcgtcatcgggcgcggtggcggcatcccc
tggaacgtgccggaagacctcgcccggttcaaagaggtgacgatcgggcacaccgtggtg
atgggccggcggacctgggactcgttgccggccaaggtgcggccgctgcccggccggcgc
aacgtcgtgctgtcccgcgaggacggcttcgccgccgacggggcgcaggtggtcggctcg
ctggacgcagccttcgcccgggccgaaggggagcccgcggtctgggtgatcggcggcggg
caggtgtatctggccgcgttgccgtacgccacccggtgcgaggtcaccgagatcgagctc
gacctgcgccgcgacgacgacgacgcgctggcgcccgccctggacgacacctgggtgggc
gagacgggggagtggcaggccagccggtccgggctgcggtaccgcttccacagctaccgt
cgctga

DBGET integrated database retrieval system