KEGG   Mycobacterium intracellulare ATCC 13950: OCU_35610Help
Entry
OCU_35610         CDS       T02158                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00900  Terpenoid backbone biosynthesis
mia01100  Metabolic pathways
mia01110  Biosynthesis of secondary metabolites
mia01130  Biosynthesis of antibiotics
Module
mia_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mia00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCU_35610
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     OCU_35610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AFC44780
UniProt: H8IWZ4
Position
complement(3797375..3798586)
Genome map
AA seq 403 aa AA seqDB search
MTNPTTDGQTPDRVRVLVLGSTGSIGTQALDVIAANPDRFEVVGLAAGGANLDTLLHQRA
ATGVTNIAVADEAAARRAGDIPFAGPEAVTRLVQETEADVVLNALVGALGLRPTLAALES
GARLALANKESLIAGGPLVLKAAKPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGG
PFRGWTAAQLEDVTPGQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGLPYDRIEV
VVHPQSIVHSMVTFVDGSTLAQASPPDMRLPIALALGWPRRVPGAAASCDFSTASSWEFE
PLDNDVFPAVELARHAGQTGGCMTAVYNAANEEAAQAFLAGRIGFGAIVKTIADVLHAAD
QWAVSPANVDEVLDAQRWARERAQRVVAQAQPANLSVKASGAV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaacccgacgaccgacgggcaaaccccggaccgcgtgcgcgtgctggtgctgggc
agcaccggctccatcggcacccaggcgctggacgtcatcgcggccaatccggaccgcttc
gaagtggtcggcctggccgcgggtggggcgaacctggacacgctgttgcaccagcgcgcc
gccaccggtgtgaccaacatcgcggtcgccgacgaagcggcggcgcggcgggccggcgac
atcccctttgccgggcccgaggccgtgacccggctggtccaggagaccgaggccgacgtc
gtcctcaacgcgctggtgggggcgctgggcctgcggcccaccctggccgcgctggagtcg
ggcgcccggttggcgctggccaacaaggaatcgctgatcgccggcggtccgctggtgctc
aaggccgccaagcccggccagatcgtgccggtcgactccgaacattccgcgctggcccag
tgcctgcgcggcgggacccccgacgaagtcgccaagctggtgctgaccgcgtccggcggc
ccgttccgcggctggaccgccgcccaactcgaggacgtcacccccgggcaagccggcgcc
cacccgacgtggtcgatgggcccgatgaacacgctgaactcggcctcgctggtcaacaag
gggctcgagctcatcgagacccacctgctgttcggccttccctatgaccgcatcgaggtg
gtcgtgcacccccagtcgattgttcattcgatggtcaccttcgtcgacggctcgaccctc
gcccaggccagcccgccggacatgaggctgccgatcgcgctggccctcggctggccacgc
cgggtgcccggcgcggccgcctcctgcgacttcagcacggcgtctagctgggaattcgag
cccctggacaacgacgtctttcccgccgtcgagttggcccggcacgccgggcagaccggc
ggctgcatgaccgcggtctacaacgccgccaacgaggaggcggcgcaggcgttcctggcg
ggccgcatcgggttcggtgccatcgtcaaaaccatcgccgacgtgctgcacgccgccgac
caatgggccgtctcacccgctaacgtggatgaggtactcgacgcgcagcgctgggcacgg
gagcgggcgcagcgtgtcgtcgcacaggcgcagcccgccaacttatcggtcaaagcctcc
ggagcggtgtga

DBGET integrated database retrieval system