KEGG   Mycobacterium intracellulare ATCC 13950: OCU_39670Help
Entry
OCU_39670         CDS       T02158                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mia00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mia00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4191692..4192180
Genome map
AA seq 162 aa AA seqDB search
MTLKDIALNTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAKDYRDRGLTVVG
VPCNQFMGQEPGTADEIQEFCSTTYGVTFPLLAKTDVNGDGRHPLYAELTKAADADGQAG
DIQWNFEKFLLAPDGAVVQRFRPRTEPDAPEVISAIEAVLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaaagacatcgccctgaacaccctcgacggccggcccaccacgctggccgaa
ttgtccgacggcgcaacgctcgtcgtcaacgtggcctccaaatgcgggctcactccgcag
tacacggcgctcgagaagctggccaaggactaccgcgaccgcggcctgaccgtcgtcggc
gtcccctgtaaccagttcatgggacaggaacccggcacggccgacgagatccaggagttc
tgctcgaccacctacggggtgacgttcccgttgttggcgaagaccgacgtcaacggcgac
ggccgccacccgctgtacgccgagttgaccaaagccgccgacgccgacggccaggcggga
gacatccagtggaacttcgagaagttcctcctcgcacccgacggtgcggtggtgcagcgc
ttccggccccgcaccgagcccgacgcccccgaggtcatcagcgccatcgaggccgtgctg
ccgcggtag

DBGET integrated database retrieval system