KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42450Help
Entry
OCU_42450         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4477502..4478341
Genome map
AA seq 279 aa AA seqDB search
MARIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEEGLNLPGVAFGHEWLAGAARYSN
LLEHLASWGIVAGAPDTQRGVAPSVLNFAFDLGTALDIVSGVCLGPGKISVHPAKLGVVG
HGFGGSAAVFAAAGMPAKLAAVAAIFPSVTSPPAQQPAATLKVPGVIFTAPGDRATLNSN
ALALAEAWKPATLRIVSKAEPGGLVEGRRLATVLGLPGPHRRTQRSVRALLTGYLLYTLG
GDKRYRDFADPDVHLPGTDAIDPEAEAIPLEEKIVALLK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcatccgcaagctcgtcgccgctctgcaccgccgtggtccgcaccgggttttg
cggggtgacctggcctttgccggtctgccgggtgtggtgtacaccccggaagagggcctg
aatctgcccggcgtggcgttcggccacgagtggctggccggcgccgcccggtactcgaat
ctgctcgagcatctggcgtcgtgggggatcgtggccggcgctcccgacacccagcggggt
gtggccccctcggtgctgaacttcgccttcgatctgggcaccgccctggacatcgtgtcg
ggtgtgtgcctcgggccgggcaagatcagcgtgcatcccgccaagctgggcgtggtcggt
catggtttcggcggctcggccgcggtattcgccgccgcggggatgcccgccaagctcgcg
gcggtggcggcgattttccccagcgtcaccagcccgccggcccagcagcccgccgcgacg
ctcaaggtgccgggagtgatcttcaccgcgccgggcgaccgggcgacgttgaactccaac
gcgctggcgcttgccgaggcgtggaagccggcgacgctgcgcatcgtcagcaaggccgag
cccggcgggctggtggagggtcggcggctggccacggtgctcggcctgcccggcccgcac
cgccgtacccagcggtcggttcgggcgctgctgaccggttacctgctctacacgctcggc
ggcgacaagaggtatcgcgatttcgccgacccggacgtgcacctgcccgggacggacgcc
atcgatcccgaggccgaggcgattcccctggaagaaaagatcgtcgccctgctgaagtga

DBGET integrated database retrieval system