KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42540Help
Entry
OCU_42540         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WXG100 T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: AFC45473
UniProt: H8IQR7
Position
complement(4484599..4484916)
Genome map
AA seq 105 aa AA seqDB search
MAAPNPLSADVDLMRSVAGTTDARNEEIRAMLQAFIGRMSGVPPSAWGGPAATRFKDVID
RWNAESVRLYHALHAIADTIRQNAATLQEAGQSHADRIAAAGGNL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaccaaacccactgagcgccgacgtcgacctgatgcggtcggtggcgggcacc
accgacgcgcgcaacgaggaaatcagggcgatgttgcaggcgttcatcggccggatgagc
ggcgtgccgccgtcggcgtggggcgggccggcggccacgcgcttcaaagacgtgatcgat
cgctggaacgccgagtcggtgcggctctaccacgccctacacgccatcgccgacaccatt
cggcagaacgcggccaccctgcaggaggccggccaaagccacgccgaccgcatcgccgcc
gccggcggaaacctgtga

DBGET integrated database retrieval system