KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42590Help
Entry
OCU_42590         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4492656..4494029)
Genome map
AA seq 457 aa AA seqDB search
MPRQPTTWLRVSAHRYLVRRTECALLGEAIYPTGPRARMPSASLAAGCVFTVLALAGCAL
LGLLSPHVALDRAQIVMSRDSGALFVRVGDVWHPVPNLASARLIAGTAADPQPIREADLE
RAKRGPLLGIPGAPQFVGRPLPAQELAFSMCDSDDASSTTVIVGPVADNGVTRMPPGQAV
LAAVSSGSPAYLLYDGHRAIVDLEDAAVVRALRLEGHAPRLVSQALLNAMPEAPPISAPR
IRGLGGAAPGLAGFRVGSVLRVTRADGDEYYAVLADGVQRIGQVAADLMRFSSSQGTVSP
ITVAPAAIRAAPVVAELPVAGFPDRAPTLPEAAGTLCASWAGGRAGVALLAGGRLPVPPG
QAAVTLAQADGRGPALDAAYVPTGRSAYVRAGDKAGTRYLIVDTGVRFAIPDDDAAHDLG
LSGPTPAPWSILTLLPAGPELSRRGASIARDAVAGSP
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcgtcagccgaccacgtggctgcgcgtcagcgctcaccggtacctcgtgcgccgc
accgaatgcgcgttgctgggcgaggcgatatacccgaccggtccccgggcgcggatgccg
tcggcatcgctggcagccgggtgtgtgttcacggtcctcgcgctggcgggctgtgcgctg
ctgggtttgctgagcccgcacgtcgcgttggatcgggcgcagatcgtgatgtcccgggac
tcgggtgcgctgttcgttcgagtgggcgatgtctggcatccggtgccgaacctggcctcc
gcgcggctcatcgcggggacggccgccgatccgcagccgatccgcgaggccgacctggag
cgcgccaaacgcggcccgctgctgggcatcccgggtgcaccgcaattcgtcggcaggccc
ctgcccgcgcaggaactggccttctcgatgtgcgacagtgacgacgccagcagcacgacg
gtcatcgtcggccccgtcgccgacaacggggtcacccgcatgccccccgggcaggccgtc
cttgccgcggtctcctcgggttcgccggcctatttgctctacgacgggcaccgggccatc
gtggacctggaagatgcggccgtcgtgcgggcgctccgactcgagggccacgcgccgcgg
ctcgtctcgcaagcgttgctgaacgccatgcccgaggcgccgccgatctcggcgccccgc
atccgcggcctcgggggcgccgcgcccgggctggcggggtttcgcgtcggcagtgtgctg
cgcgtcacacgcgccgacggtgacgagtattacgcggtgctggccgacggcgtgcagcgg
atcggccaggtcgccgccgacctgatgcgttttagcagctcccagggcacggtcagtccc
atcaccgtcgcgcccgcggcgatccgggccgcgcccgtcgtcgccgagctgcccgtggcc
ggtttccccgaccgggcgccgacgctgccggaggccgccggcacgttatgcgccagctgg
gcgggcgggcgagcgggggtggctttgctggcggggggccggctgcccgtgccgcccggt
caggcggcggtgacgctggcgcaggcggacggccggggtcccgcgctggatgccgcgtac
gtgccgaccggccgcagcgcctacgtgcgggcgggcgacaaagccggcacccgctacctg
atcgtcgacaccggggtgcgattcgccatccccgacgacgacgccgcgcacgatctcggc
ctctccgggccgaccccggcgccctggtcgatcctcacgctcttgccggcgggaccggag
ctgagcagacgcggcgcgtcaatcgcccgggacgcggtcgcgggctccccgtaa

DBGET integrated database retrieval system