KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42600Help
Entry
OCU_42600         CDS       T02158                                 

Definition
(GenBank) serine esterase, cutinase family protein
  KO
K08095  
cutinase [EC:3.1.1.74]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
Enzymes [BR:mia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.74  cutinase
     OCU_42600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4494151..4495032
Genome map
AA seq 293 aa AA seqDB search
MKTHRAARLVGLGASALVTAAGLLAAPAATPVASADDCPDVEVIFARGTNEPPGLGRVGD
AFVDSLRQQTGGLNILPYGVNYAASKLQLHGGDGANDTIDRVKKSVEKCPSTKIVLGGYS
QGASVMDIVAGVPIGGINWGNSLPPQYADNIAAVATFGDVADRAGGTLPSQSKLLGSKAI
DLCNPNDPICHAGPGNEWSGHTEGYVPVYTTQAAAFVASKLVGTGQSVPGYGPSFPGAGP
QVPGQPGYGQQTPVYGQTPPGSGPSIHGGTGTAPAPAPLAPGPVTSVPQAPLV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactcaccgtgcagctcgcctcgtcggcctgggcgcttcggccctggtgaccgcc
gccggcctcctcgccgcaccggctgcgacgccggtcgcctccgccgatgactgcccggac
gtcgaggtcatcttcgcccgcggcaccaacgagccccccggcctgggccgggttggcgat
gccttcgtggactcgctgcgtcagcagacgggcgggctgaacatcctgccctacggcgtg
aactacgccgccagcaagctgcagctgcacggcggtgacggcgccaacgacaccatcgac
cgcgtgaagaaaagcgtggagaagtgcccgagcaccaagatcgtgctgggcggctactcg
cagggcgcctcggtgatggacatcgtggccggcgtgcccatcggcggaatcaactggggc
aactcgctgccgccgcagtacgccgacaacatcgcggccgtcgccaccttcggcgacgtg
gccgaccgcgccggcggcacactgcccagccagagcaagctgctgggctccaaggccatc
gacctgtgcaaccccaacgacccgatctgccacgccggccccggcaacgagtggagcggg
cacaccgagggctacgtccccgtctacaccacccaggccgcggcgttcgtcgcgtccaag
ctcgtcggcaccggccagtcggtgcccgggtacggtccgtcgttccccggcgccggcccg
caggtcccgggccagcccgggtacggccagcagacgccggtgtacgggcagaccccgccc
gggtcgggcccctcgatccacggcggcaccggcaccgccccggcgcccgcgccgctcgcg
cccgggccggtcacgtccgtaccgcaagcacctctcgtctaa

DBGET integrated database retrieval system