KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42670Help
Entry
OCU_42670         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S13
  KO
K02952  
small subunit ribosomal protein S13
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_42670
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    OCU_42670
  Archaea
    OCU_42670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4499477..4499809)
Genome map
AA seq 110 aa AA seqDB search
MEIALTYIFGVGRTRSNEILEATGIDKNLRTRDLTDDQLTHLRDYIEANLKVEGDLRREV
QADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggagatcgcgctgacgtacatcttcggcgtcggccggacccgttcgaacgagattctc
gaagcgaccgggatcgacaagaacctgcgcaccagggacctcaccgacgaccagctgacc
cacctgcgcgactacatcgaagccaacctgaaggtggagggtgacctgcgccgcgaggtc
caggccgacatccgccgcaagatcgagatcggctgctaccagggcctgcggcaccgccgc
ggcctgccggtgcgcggccagcggaccaagaccaacgcgcgcacccgcaagggccccaag
cgcaccatcgccggcaagaagaaggccaggtaa

DBGET integrated database retrieval system