KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42680Help
Entry
OCU_42680         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_42680
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_42680
  Bacteria
    OCU_42680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L36
Motif
Other DBs
NCBI-ProteinID: AFC45487
UniProt: H8IQT1
Position
complement(4500010..4500123)
Genome map
AA seq 37 aa AA seqDB search
MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgaacccgagcgtcaagccaatctgtgacaagtgcagggtgatccgtcggcac
gggcgggtcatggtgatctgctccgatccgcgccacaagcagcgccaaggctga

DBGET integrated database retrieval system