KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42680Help
Entry
OCU_42680         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L36
  KO
K02919  
large subunit ribosomal protein L36
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    OCU_42680
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_42680
  Bacteria
    OCU_42680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4500010..4500123)
Genome map
AA seq 37 aa AA seqDB search
MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgaacccgagcgtcaagccaatctgtgacaagtgcagggtgatccgtcggcac
gggcgggtcatggtgatctgctccgatccgcgccacaagcagcgccaaggctga

DBGET integrated database retrieval system