KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42850Help
Entry
OCU_42850         CDS       T02158                                 

Definition
(GenBank) fadE9
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4517028..4518197
Genome map
AA seq 389 aa AA seqDB search
MFTLDDDERVITETAAAFAAKRLAPHALEWDAAKHFPTDVLRESAELGMAAIYCREDVGG
SGLRRLDGVRIFEQLAIADPTTAAFLSIHNMCAWMIDTFGTAEQRKDWVPRLASMDVIAS
YCLTEPGAGSDASALSTRAVKEGGDYVLDGVKQFISGAGASDVYVVMARTGGEGPRGISA
FIVEKDSAGLSFGALEEKMGWHAQPTAQVILEGVRVPADAMLGGADGEGAGFGIAMNGLN
GGRLNIAACSLGGAQAAADKAGAYVRDRQAFGKSLLDEPTIRFALADMATGLETSRMMLW
RAANALDTDDPDKVELCAMAKRYVTDTCFEVADKALQLHGGYGYLREYGLEKIVRDLRVH
RILEGTNEIMRVVIGRAEAARFRASPATA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccttgacgacgacgaacgggtgatcaccgagacggccgccgcgttcgccgcc
aagcgcctggccccgcacgccctggaatgggatgcggccaagcactttccgaccgacgtg
ctgcgtgagtcggcggagctaggcatggcggcgatctactgccgcgaggacgtcggcggc
agcgggctgcgccggctcgacggggtccgcatcttcgagcagctggcgatcgccgacccc
accaccgccgcattcctgtcgatccacaacatgtgcgcgtggatgatcgacaccttcggc
accgccgaacagcgcaaggactgggtcccgcgcctggcgtcgatggacgtcatcgccagc
tactgcctcaccgagccgggcgccggctccgacgccagcgcgttgagcacccgcgcggtc
aaagagggcggcgactatgtgctcgacggggtcaagcagttcatctcgggcgcgggcgcg
tcggacgtctacgtggtgatggccaggaccggcggcgagggcccgcgcggcatctcggcg
ttcatcgtcgaaaaggacagtgcggggctgagtttcggcgcgctggaggagaagatgggc
tggcatgcccagcccaccgcccaggtgatcctggagggcgtgcgggtgccggccgacgcg
atgctgggtggcgcggacggcgagggcgccggattcggcatcgcgatgaacggcctcaac
ggcggccggctcaacatcgccgcgtgctcgctcggtggcgcccaggccgccgccgacaag
gcgggagcctacgttcgcgatcggcaggcgttcggcaagtccctgctcgacgaaccgacc
atccggttcgccctggccgacatggcgaccggcctcgagacgtcgcgcatgatgttgtgg
cgcgcggccaatgcgttggacaccgacgaccccgacaaggtcgagttgtgcgcgatggcc
aagcgttacgtcaccgacacctgcttcgaggtcgccgacaaggccctgcagctgcacggc
ggctacggctacctgcgcgagtatggtctggaaaagatcgtgcgcgacctgcgggtgcac
cggatcctggaaggcaccaacgaaatcatgcgagtggtcatcggtcgggcagaagccgca
cggttcagagcttctccggcaaccgcatag

DBGET integrated database retrieval system